[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ecol0:carA

[Show Plain Result]

#ERROR : Can't open dsspfile "1jdbF.bssp"
#ERROR : Can't open dsspfile "1bxrB.bssp"
#ERROR : Can't open dsspfile "1c30B.bssp"
#ERROR : Can't open dsspfile "1t36B.bssp"
#ERROR : Can't open dsspfile "1cs0B.bssp"
#ERROR : Can't open dsspfile "1a9xB.bssp"
#ERROR : Can't open dsspfile "1m6vB.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "1wl8A.bssp"
#ERROR : Can't open dsspfile "2d7jA.bssp"
#ERROR : Can't open dsspfile "2ywbA.bssp"
#ERROR : Can't open dsspfile "2ywbC.bssp"
#ERROR : Can't open dsspfile "2ywbB.bssp"
#ERROR : Can't open dsspfile "1i1qB.bssp"
#ERROR : Can't open dsspfile "2ywbD.bssp"
#ERROR : Can't open dsspfile "2a9vD.bssp"
#ERROR : Can't open dsspfile "2a9vC.bssp"
#ERROR : Can't open dsspfile "2a9vB.bssp"
#ERROR : Can't open dsspfile "2a9vA.bssp"
#ERROR : Can't open dsspfile "1i7qB.bssp"
#ERROR : Can't open dsspfile "1gpmB.bssp"
#ERROR : Can't open dsspfile "1gpmA.bssp"
#ERROR : Can't open dsspfile "2ywcD.bssp"
#ERROR : Can't open dsspfile "2ywcB.bssp"
#ERROR : Can't open dsspfile "2ywcA.bssp"
#ERROR : Can't open dsspfile "2vxoA.bssp"
#ERROR : Can't open dsspfile "1s1mB.bssp"
#ERROR : Can't open dsspfile "1s1mA.bssp"

## Summary of PDB Search
:382
      0.0 100%  1jdbF  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE
      0.0 100%  1bxrB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE
      0.0 100%  1c30B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
      0.0 100%  1t36B  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE SMALL CHAIN
      0.0 100%  1cs0B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
      0.0  99%  1a9xB  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL
      0.0 100%  1m6vB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHETASE SMALL CHAIN
    2e-11  30%  1qdlB  [c.23.16] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    3e-10  30%  1wl8A  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    6e-10  38%  2d7jA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    4e-08  31%  2ywbA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    5e-07  32%  2ywbC  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    5e-07  32%  2ywbB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    5e-07  30%  1i1qB  [c.23.16] ANTHRANILATE SYNTHASE COMPONENT II
    8e-07  31%  2ywbD  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    2e-06  30%  2a9vD  [x.x.x] GMP SYNTHASE
    2e-06  30%  2a9vC  [x.x.x] GMP SYNTHASE
    2e-06  30%  2a9vB  [x.x.x] GMP SYNTHASE
    2e-06  30%  2a9vA  [x.x.x] GMP SYNTHASE
    4e-06  27%  1i7qB  [c.23.16] TRPG
    7e-06  29%  1gpmB  [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE
    7e-06  29%  1gpmA  [c.23.16 - c.26.2 - d.52.2] GMP SYNTHETASE
    3e-05  28%  2ywcD  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    3e-05  28%  2ywcB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    3e-05  28%  2ywcA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    4e-04  33%  2vxoA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING]
    6e-04  29%  1s1mB  [c.37.1 - c.23.16] CTP SYNTHASE
    6e-04  30%  1s1mA  [c.37.1 - c.23.16] CTP SYNTHASE
:382

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1jdbF           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1bxrB           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1c30B           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1t36B           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1cs0B           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1a9xB           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1m6vB           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1qdlB           ----------------------------------------------------------------------
1wl8A           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
2ywbA           ----------------------------------------------------------------------
2ywbC           ----------------------------------------------------------------------
2ywbB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
2ywbD           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1i7qB           ----------------------------------------------------------------------
1gpmB           ----------------------------------------------------------------------
1gpmA           ----------------------------------------------------------------------
2ywcD           ----------------------------------------------------------------------
2ywcB           ----------------------------------------------------------------------
2ywcA           ----------------------------------------------------------------------
2vxoA           ----------------------------------------------------------------------
1s1mB           ----------------------------------------------------------------------
1s1mA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1jdbF           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1bxrB           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1c30B           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1t36B           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1cs0B           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1a9xB           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1m6vB           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1qdlB           ----------------------------------------------------------------------
1wl8A           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
2ywbA           ----------------------------------------------------------------------
2ywbC           ----------------------------------------------------------------------
2ywbB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
2ywbD           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1i7qB           ----------------------------------------------------------------------
1gpmB           ----------------------------------------------------------------------
1gpmA           ----------------------------------------------------------------------
2ywcD           ----------------------------------------------------------------------
2ywcB           ----------------------------------------------------------------------
2ywcA           ----------------------------------------------------------------------
2vxoA           ----------------------------------------------------------------------
1s1mB           ----------------------------------------------------------------------
1s1mA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
1jdbF           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGAKRNILRMLV
1bxrB           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGAKRNILRMLV
1c30B           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
1t36B           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
1cs0B           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
1a9xB           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGAKRNILRMLV
1m6vB           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGAKRNILRMLV
1qdlB           ----------------------------------------------------------------------
1wl8A           -----------------------------------------------------IVIMDNGGQHRIWRTLR
2d7jA           -----------------------------------------------------IVIMDNGGQHRIWRTLR
2ywbA           ----------------------------------------------------------------------
2ywbC           ----------------------------------------------------------------------
2ywbB           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
2ywbD           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vB           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
1i7qB           ---------------------------------------------------------------NLVDQLR
1gpmB           -----------------------------------------------------ILILDFGSQYTVARRVR
1gpmA           -----------------------------------------------------ILILDFGSQYTVARRVR
2ywcD           ----------------------------------------------------------------------
2ywcB           ----------------------------------------------------------------------
2ywcA           ----------------------------------------------------------------------
2vxoA           -----------------------------------------------------VVILDAGYGKVIDRRVR
1s1mB           ----------------------------------------------------------------------
1s1mA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
1jdbF           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
1bxrB           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
1c30B           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGISLGHQLLALASG
1t36B           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPDDYAITAIQKFLETDIPVFGICLGHQLLALASG
1cs0B           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGI-LGHQLLALASG
1a9xB           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGI-LGHQLLALASG
1m6vB           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
1qdlB           -----------EISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDKYLGKRTPILGVCLGHQAIGYAFG
1wl8A           YLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSNTGNCE---KVLEHYDEFNVPILGICLGHQLIAKFFG
2d7jA           YLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSNTGNCE---KVLEHYDEFNVPILGICLGHQLIAKFFG
2ywbA           -------ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQELG
2ywbC           -------ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQELG
2ywbB           -------ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQELG
1i1qB           --------IPAQTLIDRLATMKNPVLMLSPGPGVPSEAGCMPELLTR-LRGKLPIIGICLGHQAIVEAYG
2ywbD           -------ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYGMQLLAQELG
2a9vD           -------------------------------------------SVGKYIDDNYPILGICVGAQFIALHFG
2a9vC           -------------------------------------------SVGKYIDDNYPILGICVGAQFIALHFG
2a9vB           -------------------------------------------SVGKYIDDNYPILGICVGAQFIALHFG
2a9vA           -------------------------------------------SVGKYIDDNYPILGICVGAQFIALHFG
1i7qB           ASGHQVVIYRNQIGAEVIIEMEQPVLMLSPGPGTPSEAGCMPELLQR-LRGQLPIIGICLGHQAIVEAYG
1gpmB           ELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTE-ENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLG
1gpmA           ELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTE-ENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLG
2ywcD           -------ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYG-QLLAQELG
2ywcB           -------ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYG-QLLAQELG
2ywcA           -------ILPGDAPLEEVLKHRPQALILSGGPRSVFDPD-APRPDPRLFSSGLPLLGICYG-QLLAQELG
2vxoA           ELFVQSEIFPLETPAFAIKEQGFRAIIISGGP---APWDPAIFTIGK------PVLGICYGMQMMNKVFG
1s1mB           -----------ETRGVEILK-GLDAILVPGGFGYRG-VEGMITTARFARENNIPYLGICLGMQVALIENG
1s1mA           -----------ETRGVEILK-GLDAILVPGGFGYRG-VEGMITTARFARENNIPYLGICLGMQVALIDYA


                         .         *         .         .         .         .         +:350
query           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1jdbF           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1bxrB           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1c30B           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1t36B           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1cs0B           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1a9xB           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1m6vB           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1qdlB           AKIRRARKVFHGKISNIILVNNSPLSLATRYHSLVVDEVHRP--LIVDAISAEDNEIMAIHHEEYPIYGV
1wl8A           GKVGRGEKAEYSDEEIFKGLPKRLKV--WESHMDEVKE--LPPKFKILARS--ETPIEAMKHEELPIYGV
2d7jA           GK--------------------------------------------------------------------
2ywbA           GRVERAEYGHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVVAET-EENPVAAIASPDGRAYGV
2ywbC           GR-VERAYGHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVVAET-EENPVAAIASPDGRAYGV
2ywbB           GR-VERAYGHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVVAET-EENPVAAIASPDGRAYGV
1i1qB           GYVGQILHGEHDGQAMFAGLANPLPV--ARYH-----SSNVPAGL--TINAHFNGMVMAVRHDADRVCGF
2ywbD           GRVERLLTRHEGPLFRGLEGEVQVWM----SHQDAV--TAPPPGWRVVAET-EENPVAAIASPDGRAYGV
2a9vD           ASVVKAKHPEFGKTK-VSVHSENIFITVWENHNDEIDDFTLAASSATCQ-------VQGFYHKTRPIYAT
2a9vC           ASVVKAKHPEFGKTK-VSVHSENIFITVWENHNDEIDDFTLAASSATCQ-------VQGFYHKTRPIYAT
2a9vB           ASVVKAKHPEFGKTK-VSVHSENIFITVWENHNDEIDDFTLAASSATCQ-------VQGFYHKTRPIYAT
2a9vA           ASVVKAKHPEFGKTK-VSVHSENIFITVWENHNDEIDDFTLAASSATCQ-------VQGFYHKTRPIYAT
1i7qB           GQVGQAGEILHGKASAIAHDGEGMFLPVARYHSLV--GSNIPADLTVNAR--FGEMVMAXXXXXXXXCGF
1gpmB           ----------------------------------------------------------------------
1gpmA           ----------------------------------------------------------------------
2ywcD           GRVERAGRAEYGTRHEGPLFRGLEGEVQVWSHQDAV--TAPPPGWRVVAET-EENPVAAIASPDGRAYGV
2ywcB           GRVERAGRAEYGTRHEGPLFRGLEGEVQVWSHQDAV--TAPPPGWRVVAET-EENPVAAIASPDGRAYGV
2ywcA           GRVERAGRAEYGTRHEGPLFRGLEGEVQVWSHQDAV--TAPPPGWRVVAET-EENPVAAIASPDGRAYGV
2vxoA           G-TVHKVFNISVDNSLFRGLQKEEVVLL--THGDSVDK--VADGFKVVARS--GNIVAGIANESKKLYGA
1s1mB           NVEVTMRLGAQQDDSLVRQLYNAPTIVERHRHRYEVNNMLLKAGLRVAGRSGDDQLVEIIEVPNHPWFAC
1s1mA           RHVANMENANSTEKYPVRDENGNVTIVERHRHRYEVNNMLLKAGLRVAGRSGDDQLVEIIEVPNHPWFAC


                         .         .         .         .         *         .         .:420
query           QGHPEASPGPHDAAPLFDHFIELIEQYRKTAK
1jdbF           QGHPEASPGPHDAAPLFDHFIELIEQYRKTA-
1bxrB           QGHPEASPGPHDAAPLFDHFIELIEQYRKT--
1c30B           QGHPEASPGPHDAAPLFDHFIELIEQYRKT--
1t36B           QGHPEASPGPHDAAPLFDHFIELIEQYRKT--
1cs0B           QGHPEASPGPHDAAPLFDHFIELIEQYRKT--
1a9xB           QGNPEASPGPHDAAPLFDHFIELIEQYRKT--
1m6vB           QGHPEASP----AAPLFDHFIELIEQYRKT--
1qdlB           QFHPES--------------------------
1wl8A           QFHPEVA-------------------------
2d7jA           --------------------------------
2ywbA           QFHPEVAHTP-KGMQILENFLEL---------
2ywbC           QFHPEVAHTP-KGMQILENFLEL---------
2ywbB           QFHPEVAHTP-KGMQILENFLEL---------
1i1qB           QFHPES--------------------------
2ywbD           QFHPEVAHTP-KGMQILENFLEL---------
2a9vD           QFHPEVEHTQY-GRDIFRNFIGICASYREIQK
2a9vC           QFHPEVEHTQY-GRDIFRNFIGICASYREIQK
2a9vB           QFHPEVEHTQY-GRDIFRNFIGICASYREIQK
2a9vA           QFHPEVEHTQY-GRDIFRNFIGICASYREIQK
1i7qB           QFHPESILTTHGA-------------------
1gpmB           --------------------------------
1gpmA           --------------------------------
2ywcD           QFHPEVAHTP--KGQILENFLEL---------
2ywcB           QFHPEVAHTP--KGQILENFLEL---------
2ywcA           QFHPEVAHTP--KGQILENFLEL---------
2vxoA           QFHPE---------------------------
1s1mB           QFHPEFTSTPRDGHPLFAGFVKAASEFQK---
1s1mA           QFHPEFTSTPRDGHPLFAGFVKAASEFQK---