[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ecol0:thiQ

[Show Plain Result]

#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2fa9B.bssp"

## Summary of PDB Search
:232
    2e-37  42%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    7e-37  41%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    7e-37  41%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-35  41%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-35  42%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    1e-35  42%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-35  42%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-35  42%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-35  42%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-35  42%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-33  42%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-32  38%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    1e-31  41%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    1e-31  41%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    4e-30  33%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    4e-30  33%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    9e-30  37%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    9e-30  38%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    9e-30  38%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    3e-29  35%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    7e-29  44%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-25  36%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-25  36%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-24  34%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    2e-24  38%  2oukB  [x.x.x] PROTEIN ARTP
    2e-24  38%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    3e-24  35%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    4e-24  37%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    4e-24  37%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    9e-24  36%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    9e-24  36%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    9e-24  36%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-23  38%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    4e-23  36%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-23  36%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    4e-23  36%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-22  35%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    4e-21  43%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-20  37%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-20  35%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-20  35%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    4e-20  32%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    6e-20  31%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-20  31%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-20  32%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    6e-20  32%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-19  30%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    1e-19  30%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-19  32%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    4e-19  32%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-19  30%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    9e-19  31%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-18  31%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    3e-18  32%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    3e-18  32%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    3e-18  33%  1ji0A  [c.37.1] ABC TRANSPORTER
    6e-18  31%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-18  40%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-17  31%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-17  32%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-17  30%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-14  31%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-13  29%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    2e-13  28%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-13  29%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  33%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    2e-12  30%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  30%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  27%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  27%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  29%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  29%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  29%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  29%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  28%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  29%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  29%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  29%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  27%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    6e-12  30%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-12  29%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    8e-12  30%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    8e-12  34%  1yqtA  [x.x.x] RNASE L INHIBITOR
    1e-11  32%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-11  32%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-11  32%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  32%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  32%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  32%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  32%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  32%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11  30%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    3e-11  28%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    4e-11  23%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-11  35%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    7e-11  32%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    1e-10  26%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  23%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-10  30%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    2e-10  27%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  36%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    2e-09  36%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    2e-09  31%  2d2fA  [x.x.x] SUFC PROTEIN
    4e-09  26%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-09  42%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-09  42%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-08  31%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-07  30%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-07  30%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-07  29%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-06  37%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    1e-06  37%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    1e-06  37%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    2e-06  30%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-06  31%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-04  39%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-04  39%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-04  39%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    1e-04  39%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    1e-04  39%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    6e-04  44%  2fa9B  [x.x.x] GTP-BINDING PROTEIN SAR1B
:232

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGSLTIDGVDHTTMPPSR
3d31A           ------------------SLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSPEK
2it1B           ------------------NLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKD
2it1A           ------------------NLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKD
2yyzA           ------------------SFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKY
1q12A           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
3fh6A           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2awoA           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2awnB           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2r6gB           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2r6gA           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2awoC           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2onkA           ----------------RLNVDFEMGRDYCVLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPER
1oxvA           ------------------NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDSNGKLIVPPED
1oxsC           ------------------NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDSNGKLIVPPED
1z47B           ------------------SFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQK
1z47A           ------------------SFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQK
1g291           ------------------SLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIDPEKGIFVPPKD
3fvqB           ------------------SLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTNTNLPVRE
3fvqA           ------------------SLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTNTNLPVRE
3dhwC           MIKLSNITKVFHQGTRTISLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESR
2awnC           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGL----------------------
1l2tB           MIKLKNVTKTYKYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIDDELTKIRR
1l2tA           MIKLKNVTKTYKYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIDDELTKIRR
1v43A           ----------------KLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKD
2oukB           ---------------------IREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXNKAKDTNLNKVR
2oljA           ---------------------IREGEVVVVIGPSGSGKSTFLNLLEDFXXXXXXXXXXNKAKDTNLNKVR
1oxxK           ------------------NINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDSNGKLIVPPED
1mt0A           ------------------NLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNR
2ff7A           ------------------NLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNR
2fgkA           ------------------NLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNR
2ffbA           ------------------NLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNR
3b5jA           ------------------NLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNR
2hydA           ------------------NLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGIKDFLTGSLR
1xefA           ------------------NLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNR
1pf4A           ------------------SFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDDYKLTNLR
2ffaA           ------------------NLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNR
2pcjA           ------------------SLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGVDYTNEKERN
2d62A           ------------------SLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYIDPEKGVFVPPKE
1f3oA           -IKLKNVTKTYKYALKNVNLNIKEGEFVSI-GPSGSGKSTL-NIIGCLDKPTEGEVYIDNIDDELTKIRR
3g60A           ------------------SLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGIKQLNVQWLR
3g5uA           ------------------SLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGIKQLNVQWLR
1b0uA           -----------HEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGADKNQLRLLR
2yz2B           ------------------SLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDG-ERKKGYEIR
2yz2A           ------------------SLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDG-ERKKGYEIR
2ixfC           LVKFQDVSFAYPNHPQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGYDHHYL---H
2ixfA           LVKFQDVSFAYPNHPQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGYDHHYL---H
1gajA           ------------------SISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAH
1g9xA           ------------------SISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAH
3gfoA           ILKVEELNYNYSHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNIDYSRIMKLR
2ixfD           LVKFQDVSFAYPNHPQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGYDHHYLHTQV
1g6hA           ------------------SISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAH
2ixeA           LVKFQDVSFAYPNHPQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGYDHHYL---H
1jj7A           LVQFQDVSFAYPNRPQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGYEHRYL---H
1mv5D           ---------------------------IAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGIDNISLENWR
1mv5A           ---------------------------IAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGIDNISLENWR
1ji0A           ------------HAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHN
2nq2D           ----------YYQAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVY--------QSI
2awnA           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2nq2C           ----------------QLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVY--------QSI
2ixeD           LVKFQDVSFAYPNHPQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGYDHHYLHTQV
2ixgA           LVKFQDVSFAYPNHPQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGYDHHYL---H
3bk7A           ---------------------IRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWD------LTVAY
2ghiA           -IEFSDVNFSYHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGVNKYNRNSIR
1xmiB           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2bbtB           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2ghiD           -IEFSDVNFSYHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGVNKYNRNSIR
2bbtA           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2bbsB           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2pzfB           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2pzfA           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2bbsA           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1xmiE           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1xmiC           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
1xmiA           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2pzgB           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2pzgA           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2pzeB           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2pzeA           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2ghiC           -IEFSDVNFSYHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGVNKYNRNSIR
1xmiD           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
3b60A           -LEFRNVTFTYREVPANINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDEYTLASLR
1z2rA           ------------------NLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDEYTLASLR
1yqtA           ---------------------IKKGEVIGIVGPNGIGKTTFVKL-AGVEEPTEGKIEWD------LTVAY
1l7vC           ---------------------VRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPLEAWSATK
1r10A           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0zD           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0zC           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0zB           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0zA           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0xD           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0xC           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0xB           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0xA           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0wC           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0wB           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1r0wA           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1q3hD           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1q3hC           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1q3hB           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1q3hA           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xfaA           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xf9D           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xf9C           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xf9B           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
1xf9A           ------------------NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG----------
2ghiB           -IEFSDVNFSYHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGVNKYNRNSIR
1sgwA           ----------------RITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKPEE
1vplA           --------------------------------PNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHER
2pjzA           ------------------------GEKVIILGPNGSGKTTLLRAISGLL-PYSGNIFINGME--------
2qi9C           ---------------------VRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPLEAWSATK
1xmjA           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2ihyA           ----------------KISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGYSAETVR
2cbzA           -------TWARSDPPTLNGITIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKG-SVAYVPQQA
2bboA           ---------------------IERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----------
2ix3A           -------------------LRLKRARRYGICGPNGCGKSTLMRAIANG--------QVDGF------PTQ
2iwhB           -------------------LRLKRARRYGICGPNGCGKSTLMRAIANG--------QVDGF------PTQ
2d2fA           ------------------NLVVPKGEVHALMGPNGAGKSTLGKILAGEYTVERGEILLDGENILELSPAR
2ihyB           ----------------KISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFG----------
2awoD           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2awnD           ------------------NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2d2eA           ------------------NLVVPKGEVHALMGPNGAGKSTLGKILAGEYTVERGEILLDGENILELSPDE
2zu0C           ------------------SLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSPED
2d3wA           ------------------SLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSPED
2d3wB           ------------------SLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSPED
2ix8A           -------------------LRLKRARRYGICGPNGCGKSTLRAIANG---------QVDGF------PTQ
2iw3B           -------------------LRLKRARRYGICGPNGCGKSTLRAIANG---------QVDGF------PTQ
2iw3A           -------------------LRLKRARRYGICGPNGCGKSTLRAIANG---------QVDGF------PTQ
2d3wD           ------------------SLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSPED
2d3wC           ------------------SLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLALSPED
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2fa9B           --------------------------KLVFLGLDNAGKTTLLHMLKPTLHPTSEELTIAGMTFTT-----


                         .         .         *         .         .         .         .:140
query           RPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQGKMHAIARQMGIDNLMARLPGELSGGQRQRVAL
3d31A           HDIAFVYQNYSLFPHMNVKKNLEFGM----RMKKIKDPKVLDTARDLKIEHLLDRNPLTLSGGEQQRVAL
2it1B           RNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAI
2it1A           RNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAI
2yyzA           REVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSGGQQQRVAL
1q12A           RGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEVINQ-RVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
3fh6A           RGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEVINQ-RVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
2awoA           RGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEVINQ-RVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
2awnB           RGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEVINQ-RVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
2r6gB           RGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEVINQ-RVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
2r6gA           RGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEVINQ-RVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
2awoC           RGVGMVA----LYPHLSVAENMSFGLKAGAKKEVINQ-RVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
2onkA           RGIGFVPQDYALFPHLSVYRNIAYGLXXXXXXXXXXXXXX--MAEKLGIAHLLDRKPARLSGGERQRVAL
1oxvA           RKIGMVFQTWALYPNLTAFENIAFPLT-NMKMSKEERKRVEEVAKILDIHHVLNHFPRELSGGQQQRVAL
1oxsC           RKIGMVFQTWALYPNLTAFENIAFPLT-NMKMSKEERKRVEEVAKILDIHHVLNHFPRELSGGQQQRVAL
1z47B           RNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPHELSGGXXXXXXX
1z47A           RNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPHELSGGXXXXXXX
1g291           RDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELSGGQRQRVAL
3fvqB           RRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGXXXXXXX
3fvqA           RRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGXXXXXXX
3dhwC           RQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAI
2awnC           -GVGMVFQSYALYPHLSVAENMSFGLKAGAKKEVINQ-RVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
1l2tB           DKIGFVFQQFNLIPLLTALENVELPLI--FKYRGAMSGEER---RKRALECLMAELPNQLSGGQQQRVAI
1l2tA           DKIGFVFQQFNLIPLLTALENVELPLI--FKYRGAMSGEER---RKRALECLMAELPNQLSGGQQQRVAI
1v43A           RNISMVFQ------HMTVYENIAFPLKKFPKDEI--DKRVRWAAELLQIEELLNRYPAQLSGGXXXXXXX
2oukB           EEVGMVFQRFNLFPHMTVLNNITLA---PMKVRKWPREKAEAKAMELGLKDKAHAYPDSLSGGQAQRVAI
2oljA           EEVGMVFQRFNLFPHMTVLNNITLA---PMKVRKWPREKAEAKAMELGLKDKAHAYPDSLSGGQAQRVAI
1oxxK           RKIGMVFQTWALYPNLTAFENIAFPLT-NMKMSKEERKRVEEVAKILDIHHVLNHFPRELSGXXXXXXXX
1mt0A           RQVGVVLQDNVLLNR-SIIDNISLA-NPGMSVEKVIYAAKLAGAHDFGYNTIVGEQGAGLSGGQRQRIAI
2ff7A           RQVGVVLQDNVLLNR-SIIDNISLA-NPGMSVEKVIYAAKLAGAHDFGYNTIVGEQGAGLSGGQRQRIAI
2fgkA           RQVGVVLQDNVLLNR-SIIDNISLA-NPGMSVEKVIYAAKLAGAHDFGYNTIVGEQGAGLSGGQRQRIAI
2ffbA           RQVGVVLQDNVLLNR-SIIDNISLA-NPGMSVEKVIYAAKLAGAHDFGYNTIVGEQGAGLSGGQRQRIAI
3b5jA           RQVGVVLQDNVLLNR-SIIDNISLA-NPGMSVEKVIYAAKLAGAHDFGYNTIVGEQGAGLSGGQRQRIAI
2hydA           NQIGLVQQDNILFSD-TVKENILLGRPTATDEEVVEAAKMHDFIMNLGYDTEVGERGVKLSGGQKQRLSI
1xefA           RQVGVVLQDNVLLNR-SIIDNISLA-NPGMSVEKVIYAAKLAGAHDFGYNTIVGEQGAGLSGGQRQRIAI
1pf4A           RHFALVSQNVHLFND-TIANNIAYAAEGEYTREQIEQAARQAHAMEFGLDTVIGENGTSLSGGQRQRVAI
2ffaA           RQVGVVLQDNVLLNR-SIIDNISLA-NPGMSVEKVIYAAKLAGAHDFGYNTIVGEQGAGLSGGQRQRIAI
2pcjA           RKLGFVFQFHYLIPELTALENV---IVPMLKMGAKERGEY--LLSELGLGDKLSRKPYELSGGEQQRVAI
2d62A           RDVAV-FQSYALYPH-TVYDNIAFPL----KLRKVPKQEIDKRVRELGLTELLNRKPRELSGGQRQRVAL
1f3oA           DKIGFVFQQFNLIPLLTALENVEL------PLIFKYRGASGEERRKRALECLKAELPNQLSGGQQQRVAI
3g60A           AQLGIVSQEPILFD-CSIAENIAYGDNS----RVVSYEEIVRAAKEANIHQFIDSLPDQLSGGQKQRIAI
3g5uA           AQLGIVSQEPILFD-CSIAENIAYGDNS----RVVSYEEIVRAAKEANIHQFIDSLPDQLSGGQKQRIAI
1b0uA           TRLTMVFQHFNLWSHMTVLENVMEAPIQGLSKHDARERALKYLAK-VGIDEAQGKYPVHLSGGQQQRVSI
2yz2B           RNIGIAFQEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLDFDSFKDRVPFFLSGGEKRRVAI
2yz2A           RNIGIAFQEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLDFDSFKDRVPFFLSGGEKRRVAI
2ixfC           TQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFGYDTEVGETGNQLSGGQRQAVAL
2ixfA           TQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFGYDTEVGETGNQLSGGQRQAVAL
1gajA           YGIVRTFQTPQPLKEMTVLENLLIGINPGSPLNSLMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEI
1g9xA           YGIVRTFQTPQPLKEMTVLENLLIGINPGSPLNSLMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEI
3gfoA           ESIGIVFQDNQLFS-ASVYQDVSFGVNMKLPEDEIRKRVDNALKRT-GIEHLKDKPTHCLSFGQKKRVAI
2ixfD           AAVGQL-----LFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFGYDTEVGETGNQLSGGQRQAVAL
1g6hA           YGIVRTFQTPQPLKEMTVLENLLIGICPGSPLNSLMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEI
2ixeA           TQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFGYDTEVGETGNQLSGGQRQAVAL
1jj7A           RQVAAVGQEPQVFGR-SLQENIAYGLTQKPTMEEITAAAVKSGAHSFGYDTEVDEAGSQLSGGQRQAVAL
1mv5D           SQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDEDLWQVLDLAFARSF-VENMPDQLNTEISGGQRQRLAI
1mv5A           SQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDEDLWQVLDLAFARSF-VENMPDQLNTEISGGQRQRLAI
1ji0A           RGIALVPEGRRIFPELTVYENLG----------AYNRKDKEGIKRDLRLKERLKQLGGTLSGGE-QQLAI
2nq2D           GFVPQFFSSPFAYSVLDI---VLMGRSTHINTFAKPKSHDYQVAMQLNLTHLAKREFTSLSGGQRQLILI
2awnA           RGVGMVFQ--------------------SYALEVINQ-RVNQVA---------------------EVLAI
2nq2C           GFVPQFFSSPFAYSVLDI---VLMGRSTHINTFAKPKSHDYQVAMQLNLTHLAKREFTSLSGGQRQLILI
2ixeD           AAVGPL-----LFGR-SFRENIAYGLTRTPTMEEIT-----AVAMESGAHDFISGFPQQLSGGQRQAVAL
2ixgA           TQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEEITAVAMESGAHDFGYDTEVGETGNQLAVGQRQAVAL
3bk7A           KPQYIKAEYEGTVYEL---------------LSKIDSSKLNSLLKPLGIIDLYDRNVEDLSGGELQRVAI
2ghiA           SIIGIVPQDTILFNE-TIKYNILYG-----KLDATDEEVIKATALPKKWDTIVGNKGMKLSGGERQRIAI
1xmiB           -RISFCSQFSWIMPG-TIKENIIAGVS-------YDEYRYRSVIKACQLEEDISKIVLTLSGGQRARISL
2bbtB           -RISFCSQ-NSWIMPGTIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGIT--LSGGQRARISL
2ghiD           SIIGIVPQDTILFNE-TIKYNILYG-----KLDATDEEVIKATKSAQLYDFIEA-LPKKLSGGERQRIAI
2bbtA           -RISFCSQ-NSWIMPGTIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIV--LGGTLSGGQRARISL
2bbsB           -RISFCSQ-NSWIMPGTIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIV--LGGTLSGGQRARISL
2pzfB           -RISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSGGQRARISL
2pzfA           -RISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSGGQRARISL
2bbsA           -RISFCSQ-NSWIMPGTIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLIT---LSGGQRARISL
1xmiE           -RISFCSQFSWIMPG-TIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSGGQRARISL
1xmiC           -RISFCSQFSWIMPG-TIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSGGQRARISL
1xmiA           -RISFCSQFSWIMPG-TIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSGGQRARISL
2pzgB           -RISFCSQFSWIMPG-TIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGIT--LSGGQRARISL
2pzgA           -RISFCSQFSWIMPG-TIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSGGQRARISL
2pzeB           -RISFCSQFSWIMPG-TIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSGGQRARISL
2pzeA           -RISFCSQFSWIMPG-TIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSGGQRARISL
2ghiC           SIIGIVPQDTILFNE-TIKYNILYG-----KLDATEEVIKATKSAQLALPKKWDTIVGGMKLGERQRIAI
1xmiD           -RISFCSQFSWIMPG-TIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVL---GELSGGQRARISL
3b60A           NQVALVSQNVHLFND-TVANNIAYARTEEYSREQIEEAARMAYAMDFGLDTIIGENGVLLSXXXXXXXXX
1z2rA           NQVALVSQNVHLFND-TVANNIAYARTEEYSREQIEEAARMAYAMDFGLDTIIGENGVLLSXXXXXXXXX
1yqtA           KPQYIKADYEGTVYEL---------------LSKIDASKLNSLLKPLGIIDLYDREVNELSGGELQRVAI
1l7vC           LALHRAYLSQQVWHYLTLHQH-----------DKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRL
1r10A           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0zD           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0zC           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0zB           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0zA           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0xD           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0xC           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0xB           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0xA           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0wC           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0wB           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1r0wA           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1q3hD           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1q3hC           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1q3hB           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1q3hA           -RVSFCSQFSWIMPG-TIKENIIFGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1xfaA           -RVSFCSQFSWIMPG-TIKENIIRGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1xf9D           -RVSFCSQFSWIMPG-TIKENIISGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1xf9C           -RVSFCSQFSWIMPG-TIKENIISGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1xf9B           -RVSFCSQFSWIMPG-TIKENIISGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
1xf9A           -RVSFCSQFSWIMPG-TIKENIISGVSYDVKACQLQQD----ITKFAEQDNTVLGEGGTLSGGQRARISL
2ghiB           SIIGIVPQDTILFNE-TIKYNILYG-----KLDATDEEVIKATKSAQLYDFIEA-LPKKLSGGERQRIAI
1sgwA           IIVPRKISVEDYLK--AVASLYGVKVNKNEIMDALESVEVLDLKKKL----------GELSQGTIRRVQL
1vplA           KLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLI
2pjzA           --VRKIRNYIRYSTNLPEAYEIGVTVNDIVYLYEELKG----LDRDLFLEMLKALKLGELSAGQSVLVRT
2qi9C           LALHRAYLSQQVWHYLTLHQH-----------DKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRL
1xmjA           -RISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSEGQQAKISL
2ihyA           QHIG--FVSHSLLEKFQEGERV-IDVVISGAIDDEIRNEAHQLLKLVGSAKAQQYI-GYLSTGEKQRV-I
2cbzA           WIQNDSLRENILFGYRSVIQ--ACALLPDLEI--LPSGDRTEIGEK-GVN---------LSGGQKQRVSL
2bboA           -RISFCSQFSWIMPG-TIKENIGVSYDEYRYRSVIKACQLEEISKFAEKDNIVLGEGGTLSEGQQAKISL
2ix3A           EECRTVYVEHDITSVLDFVFESGVGTKEAIKDKLIEFGFT---------DEMIAMPISALSGGWKMKLAL
2iwhB           EECRTVYVEHDITSVLDFVFESGVGTKEAIKDKLIEFGFT---------DEMIAMPISALSGGWKMKLAL
2d2fA           KGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELESYLSRYLNEFSGGEKKRNEI
2ihyB           KPGKVGYSAETVRQHIGFVSHIDVVISGAFKSIGVYQNEAHQLLKLVGSAKAQQYI-GYLSTGEKQRV-I
2awoD           RGVGMV----------------------------------------------------------------
2awnD           RGVGMV----------------------------------------------------------------
2d2eA           RARKGLFLQYPVVPGVTIANFLRLALQAGREVGVAEFWTKVKKALEL-LDWDESYLSRYLNEGEKKRNEI
2zu0C           RAGEGIFM---AFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMLKMPEDLSGGEKKRNDI
2d3wA           RAGEGIFM---AFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMLKMPEDLSGGEKKRNDI
2d3wB           RAGEGIFM---AFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMLKMPEDLSGGEKKRNDI
2ix8A           EECRTVYVEHDITSVLDFVFESGVGTKEAIKDKLIEFGFTDEIAPISA-----------LSGGWK-KLAL
2iw3B           EECRTVYVEHDITSVLDFVFESGVGTKEAIKDKLIEFGFTDEIAPISA-----------LSGGWK-KLAL
2iw3A           EECRTVYVEHDITSVLDFVFESGVGTKEAIKDKLIEFGFTDEIAPISA-----------LSGGWK-KLAL
2d3wD           RAGEGIFM---AFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMLKMPEDLSGGEKKRNDI
2d3wC           RAGEGIFM---AFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMLKMPEDLSGGEKKRNDI
2vf8B           --------------------------------------------REVGLGYLRLGQPAELSGGEAQRIKL
2vf8A           --------------------------------------------REVGLGYLRLGQPAELSGGEAQRIKL
2vf7C           --------------------------------------------REVGLGYLRLGQPAELSGGEAQRIKL
2vf7B           --------------------------------------------REVGLGYLRLGQPAELSGGEAQRIKL
2vf7A           --------------------------------------------REVGLGYLRLGQPAELSGGEAQRIKL
2fa9B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAW
3d31A           ARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARIMADRIAVVMDGKLIQ
2it1B           ARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQ
2it1A           ARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQ
2yyzA           ARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVFNQGKLVQ
1q12A           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
3fh6A           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2awoA           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2awnB           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2r6gB           GRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2r6gA           GRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2awoC           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2onkA           ARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLADEVAVMLNGRIVE
1oxvA           ARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR-----------
1oxsC           ARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR-----------
1z47B           XXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQ
1z47A           XXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQ
1g291           GRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQ
3fvqB           XXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRI--
3fvqA           XXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRI--
3dhwC           ARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIE
2awnC           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
1l2tB           ARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDI-NVARFGERIIYLKDGEV--
1l2tA           ARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDI-NVARFGERIIYLKDGEV--
1v43A           XXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQ
2oukB           ARALAMEPKIMLFDEPTSALDPEMVGEVLS-VMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIE
2oljA           ARALAMEPKIMLFDEPTSALDPEMVGEVLS-VMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIE
1oxxK           XXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADR-----------
1mt0A           ARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGR--TVIIIAHRL-STVKNADRIIVMEKGKIVE
2ff7A           ARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGR--TVIIIAHRL-STVKNADRIIVMEKGKIVE
2fgkA           ARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGR--TVIIIAHRL-STVKNADRIIVMEKGKIVE
2ffbA           ARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGR--TVIIIAHRL-STVKNADRIIVMEKGKIVE
3b5jA           ARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGR--TVIIIAHRL-STVKNADRIIVMEKGKIVE
2hydA           ARIFLNNPPILILDEATSALD--LESESIIQEALDVLSKDRTTLIVAHRLSTITH-ADKIVVIENGHIVE
1xefA           ARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLS---TVKNADRIIVMEKGKIVE
1pf4A           ARALLRDAPVLILDEATSALD--TESERAIQAALDELQKNKTVLVIAHRLSTIEQ-ADEILVVDEGEIIE
2ffaA           ARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAARLS---TVKNADRIIVMEKGKIVE
2pcjA           ARALANEPILLFADEPTGNLDSANTKRVMD-IFLKINEGGTSIVMVTHE-RELAELTHRTLEMKDGKV--
2d62A           GRAIIR-RPKVFLDEPLSNLDAKLRVKRAELKKLQ-RQLGVTTIYVTHDQVEA-----------------
1f3oA           ARALANNPPIILADEPTGALD-SKTGEKIQLLKKLNEEDGKTVVVVTHDI-NVARFGERIIYLKDGEV--
3g60A           ARALVRQPHILLLDEATSALD--TESEKVVQEALDKAREGRTCIVIAHRL-STIQNADLIVVIQNGKVKE
3g5uA           ARALVRQPHILLLDEATSALD--TESEKVVQEALDKAREGRTCIVIAHRL-STIQNADLIVVIQNGKVKE
1b0uA           ARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGK-TMVVVTHEMGFARHVSSHVIFLHQGKIEE
2yz2B           ASVIVHEPDILILDEPLVGLDREGKTDLLRIVE-KWKTLGKTVILISHDIETVINHVDRVVVLEKGKKVF
2yz2A           ASVIVHEPDILILDEPLVGLDREGKTDLLRIVE-KWKTLGKTVILISHDIETVINHVDRVVVLEKGKKVF
2ixfC           ARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITHQLSLAER-AHHILFLKEGSVCE
2ixfA           ARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITHQLSLAER-AHHILFLKEGSVCE
1gajA           GRALMTNPKMIVMDQPIAGVAPGLAHDIFNHV-LELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIA
1g9xA           GRALMTNPKMIVMDEPIAGVAPGLAHDIFNHV-LELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIA
3gfoA           AGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGXXXXXXXXXXXXVPLYCDNVFVMKEGRVIL
2ixfD           ARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLITHQLSLAER-AHHILFLKEGSVCE
1g6hA           GRALMTNPKMIVMDEPIAGVAPGLAHDIFNHV-LELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIA
2ixeA           ARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAER-AHHILFLKEGSVCE
1jj7A           ARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLIT-----------------------
1mv5D           ARAFLRNPKILMLDEATASLDS--ESESMVQKALDSLMKGRTTLVIAHRLSTIVD-ADKIYFIEKGQITG
1mv5A           ARAFLRNPKILMLDEATASLDS--ESESMVQKALDSLMKGRTTLVIAHRLSTIVD-ADKIYFIEKGQITG
1ji0A           GRALSRPK---LLDEPSLGLAPILVSEVFEVIQ-KINQEGTTILLVEQNALGALKVAHYGYVLETGQIVL
2nq2D           ARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAIANKTLLL-------
2awnA           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2nq2C           ARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAIANKTLLL-------
2ixeD           ARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAER-AHHILFLKEGSVCE
2ixgA           ARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLSLAER-AHHILFLKEGSVCE
3bk7A           AATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRLIV--------
2ghiA           ARCLLKDPKIVIFDEATSSLDS--KTEYLFQKAVEDLRKNRTLIIIAHRLSTISS-AESIILLNKGKIVE
1xmiB           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2bbtB           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2ghiD           ARCLLKDPKIVIFDD-------------------------------------------------------
2bbtA           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2bbsB           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2pzfB           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2pzfA           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2bbsA           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
1xmiE           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
1xmiC           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
1xmiA           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2pzgB           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2pzgA           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2pzeB           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2pzeA           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2ghiC           ARCLLKDPKIVIFDEATSSLDS--KTEYLFQKAVEDLRKNRTLIIIAHRLSTISS-AESIILLNKGKIVE
1xmiD           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
3b60A           XXXXXXDSPILILDEATSALD--TESERAIQAALDELQKNRTSLVIAH----------------------
1z2rA           XXXXXXDSPILILDEATSALD--TESERAIQAALDELQKNRTSLVIAH----------------------
1yqtA           AATLLRDADIYLLDEPSAYLDVEQRLAVSRAI-RHLEKNEKTALVVEHDV--------------------
1l7vC           AAVVLQITPLLLLDEP-NSLDVAQQSALDKILSALCQQG--LAIVSSHDLNHTLRHAHRAWLLKGGKLA-
1r10A           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0zD           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0zC           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0zB           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0zA           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0xD           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0xC           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0xB           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0xA           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0wC           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0wB           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1r0wA           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1q3hD           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1q3hC           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1q3hB           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1q3hA           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1xfaA           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1xf9D           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1xf9C           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1xf9B           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
1xf9A           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKM--EHLRKADKILILHQGSSYF
2ghiB           ARCLLKDPKIVIFDEATS----DSKTEYLFQKAVEDLRKNRTLIIIAHRTISSAE---SIILLNKGKIVE
1sgwA           ASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVII--------------------------
1vplA           ARALMVNPRLAILDEPTSGLDVLNAREVRKILK-QASQEGLTILVSSHNMLEVEFLCDRIALIHNGTIVE
2pjzA           SLALASQPEIVGLDEPFENVDAARRH----VISRYIKEYGKEGILVTHELD-------------------
2qi9C           AAVVLQITPLLLLDEP-NSLDVA-QQSALDKILSALSQQGLAIVS-SHDLNHTLRHAHRAWLLKGGKLA-
1xmjA           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2ihyA           ARALGQPQ-VLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEITANFSKILLLKDGQSIQ
2cbzA           ARAVYSNADIYLFDDPLSAVDAHVGKHIFNVIGPKGMLKNKTRILVTHSMSYLPQVDV-IIVMSGGKISE
2bboA           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM--EHLKKADKILILHEGSSYF
2ix3A           ARAVLRNADILLLDEPTNHLD-------------------------------------------------
2iwhB           ARAVLRNADILLLDEPTNHLD-------------------------------------------------
2d2fA           LQLLVLEPTYAVLDETDSGLD-------------------------------------------------
2ihyB           ARALGQPQ-VLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYVTHFIEEITANFSKILLLKDGQSIQ
2awoD           ------EPSVFLLDEP---LDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2awnD           ------EPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2d2eA           LQLLVLEPTYAVLDETDSGLD-------------------------------------------------
2zu0C           LQMAVLEPELCILDESDSGLDIDALKVVADGVN-SLRDGKRSFIIVTH----------------------
2d3wA           LQMAVLEPELCILDESDSGLDIDALKVVADGVN-SLRDGKRSFIIVTH----------------------
2d3wB           LQMAVLEPELCILDESDSLDIDALK--VVADGVNSLRDGKRSFIIVTH----------------------
2ix8A           ARAVLRNADILLLDEPTNHLD-------------------------------------------------
2iw3B           ARAVLRNADILLLDEPTNHLD-------------------------------------------------
2iw3A           ARAVLRNADILLLDEPTNHLD-------------------------------------------------
2d3wD           LQMAVLEPELCILDE-----SDGLDIDALKVVANSLRDGKRSFIIVTH----------------------
2d3wC           LQMAVLEPELCILDE-------------------------------------------------------
2vf8B           ATELRRSGTVYVLDEPTTGLHPALQRQLVKLVDAG-----NTVIAVEHKMQVVA----------------
2vf8A           ATELRRSGTVYVLDEPTTGLHPALQRQLVKLVDAG-----NTVIAVEHKMQVVA----------------
2vf7C           ATELRRSGTVYVLDEPTTGLHPALQRQLVKLVDAG-----NTVIAVEHKMQVVA----------------
2vf7B           ATELRRSGTVYVLDEPTTGLHPALQRQLVKLVDAG-----NTVIAVEHKMQVVA----------------
2vf7A           ATELRRSGTVYVLDEPTTGLHPALQRQLVKLVDAG-----NTVIAVEHKMQVVA----------------
2fa9B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QGMTNExxxxxxxxxxxxxxxx
3d31A           VGKPEE----------------
2it1B           VGTPDE----------------
2it1A           VGTPDE----------------
2yyzA           YGTPDE----------------
1q12A           VG--------------------
3fh6A           VG--------------------
2awoA           VG--------------------
2awnB           VG--------------------
2r6gB           VG--------------------
2r6gA           VG--------------------
2awoC           VG--------------------
2onkA           KGKLKE----------------
1oxvA           ----------------------
1oxsC           ----------------------
1z47B           FGTPEE----------------
1z47A           FGTPEE----------------
1g291           VGSPDE----------------
3fvqB           ----------------------
3fvqA           ----------------------
3dhwC           QDTVSE----------------
2awnC           VG--------------------
1l2tB           ----------------------
1l2tA           ----------------------
1v43A           IGSPTE----------------
2oukB           EG--------------------
2oljA           EG--------------------
1oxxK           ----------------------
1mt0A           QG--------------------
2ff7A           QG--------------------
2fgkA           QG--------------------
2ffbA           QG--------------------
3b5jA           QG--------------------
2hydA           TGTHRE----------------
1xefA           QG--------------------
1pf4A           RG--------------------
2ffaA           QG--------------------
2pcjA           ----------------------
2d62A           ----------------------
1f3oA           ----------------------
3g60A           HG--------------------
3g5uA           HG--------------------
1b0uA           EG--------------------
2yz2B           DGTRME----------------
2yz2A           DGTRME----------------
2ixfC           QG--------------------
2ixfA           QG--------------------
1gajA           EGRGEE----------------
1g9xA           EGRGEE----------------
3gfoA           QGNPKE----------------
2ixfD           QG--------------------
1g6hA           EGRGEE----------------
2ixeA           QG--------------------
1jj7A           ----------------------
1mv5D           SGKHNE----------------
1mv5A           SGKHNE----------------
1ji0A           EGKASE----------------
2nq2D           ----------------------
2awnA           VG--------------------
2nq2C           ----------------------
2ixeD           QG--------------------
2ixgA           QG--------------------
3bk7A           ----------------------
2ghiA           KG--------------------
1xmiB           YGTFSE----------------
2bbtB           YGTFSE----------------
2ghiD           ----------------------
2bbtA           YGTFSE----------------
2bbsB           YGTFSE----------------
2pzfB           YGTFSE----------------
2pzfA           YGTFSE----------------
2bbsA           YGTFSE----------------
1xmiE           YGTFSE----------------
1xmiC           YGTFSE----------------
1xmiA           YGTFSE----------------
2pzgB           YGTFSE----------------
2pzgA           YGTFSE----------------
2pzeB           YGTFSE----------------
2pzeA           YGTFSE----------------
2ghiC           KG--------------------
1xmiD           YGTFSE----------------
3b60A           ----------------------
1z2rA           ----------------------
1yqtA           ----------------------
1l7vC           ----------------------
1r10A           YGTFSE----------------
1r0zD           YGTFSE----------------
1r0zC           YGTFSE----------------
1r0zB           YGTFSE----------------
1r0zA           YGTFSE----------------
1r0xD           YGTFSE----------------
1r0xC           YGTFSE----------------
1r0xB           YGTFSE----------------
1r0xA           YGTFSE----------------
1r0wC           YGTFSE----------------
1r0wB           YGTFSE----------------
1r0wA           YGTFSE----------------
1q3hD           YGTFSE----------------
1q3hC           YGTFSE----------------
1q3hB           YGTFSE----------------
1q3hA           YGTFSE----------------
1xfaA           YGTFSE----------------
1xf9D           YGTFSE----------------
1xf9C           YGTFSE----------------
1xf9B           YGTFSE----------------
1xf9A           YGTFSE----------------
2ghiB           KG--------------------
1sgwA           ----------------------
1vplA           TGTVEE----------------
2pjzA           ----------------------
2qi9C           ----------------------
1xmjA           YGTFSE----------------
2ihyA           QGAVED----------------
2cbzA           MGSYQE----------------
2bboA           YGTFSE----------------
2ix3A           ----------------------
2iwhB           ----------------------
2d2fA           ----------------------
2ihyB           QGAVED----------------
2awoD           VG--------------------
2awnD           VG--------------------
2d2eA           ----------------------
2zu0C           ----------------------
2d3wA           ----------------------
2d3wB           ----------------------
2ix8A           ----------------------
2iw3B           ----------------------
2iw3A           ----------------------
2d3wD           ----------------------
2d3wC           ----------------------
2vf8B           ----------------------
2vf8A           ----------------------
2vf7C           ----------------------
2vf7B           ----------------------
2vf7A           ----------------------
2fa9B           ----------------------