[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ecol0:hisQ

[Show Plain Result]

#ERROR : Can't open dsspfile "3dhwA.bssp"

## Summary of PDB Search
:228
    6e-05  30%  3dhwA  [x.x.x] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLIRGVPDLVLMLLIFY
3dhwA           ------------------------------------------------------IFRSIPFIILLVWMIP


                         .         .         *         .         .         .         .:140
query           GLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTRGQVFRR
3dhwA           FTRVIVGT---SIGL-QAAIVPLTVGA-------APFIARMVENALLEIPTGLIEASRAMGATPMQIVRK


                         +         .         .         .         .         *         .:210
query           IMFPSMMRYALPGIGNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA           VLLPE----ALPGLVN------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxx
3dhwA           ------------------