[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ecol0:malG

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG.bssp"
#ERROR : Can't open dsspfile "3fh6G.bssp"
#ERROR : Can't open dsspfile "2onkC.bssp"
#ERROR : Can't open dsspfile "3d31C.bssp"

## Summary of PDB Search
:296
    e-146 100%  2r6gG  [x.x.x] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    e-123 100%  3fh6G  [x.x.x] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    6e-10  30%  2onkC  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE
    1e-07  29%  3d31C  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, PERMEASE
:296

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxMVQPKSQKXXXXXXXXXXXXXXXXXXXXXXMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQA
2r6gG           --------------------------------MVVAISLRQGNFATGSLIPEQISWDHWKLALGFSV---
3fh6G           --MVQPKSQKXXXXXXXXXXXXXXXXXXXXXXMVVAISLRQ-----------------------------
2onkC           ----------------------------------------------------------------------
3d31C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
2r6gG           ---ITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
3fh6G           --RITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
2onkC           -----------------------ISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIAL
3d31C           -------------------------------------YILARFDFPGKRLVESIIDVPVVVPHTVAGIAL


                         +         .         .         .         .         *         .:210
query           YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
2r6gG           YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
3fh6G           YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
2onkC           LVVFGSIGSFSPLKFVDALPGIVVAMLVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPL
3d31C           LTVFGSRGSYIQF--RDALPGIVVAMLFSMPYLANSAREGFKSVDPRLENAARSLGAPLWKAFFFVTLPL


                         .         .         .         +         .         .         .:280
query           SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
2r6gG           SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
3fh6G           SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
2onkC           SVRHIVAGAIMSWARGISE---------------------------------FGAVVVIAYYPMIAPTLI
3d31C           SARYLLIGSVMTWARAISEFGAVVIL-----AYYPMVG-------PTLIYDRFISYGLSASRPIAVLLIL


                         .         *         .         .         .         .         +:350
query           AQRWLVNGLTAGGVKG
2r6gG           AQRWLVNGLTAGGVKG
3fh6G           AQRWLVN---------
2onkC           YERYLSEGLSA-----
3d31C           ----------------