[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ecol0:dgkA

[Show Plain Result]

#ERROR : Can't open dsspfile "2kdcA.bssp"

## Summary of PDB Search
:122
    1e-58 100%  2kdcA  [x.x.x] DIACYLGLYCEROL KINASE
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVE
2kdcA           -ANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVE


                         .         .         *         .         .         .         .:140
query           ILNSAIEAVVDRIGSEYHELSGRAKDMGSXXXXXXXXXXXXTWCILLWSHFG
2kdcA           ILNSAIEAVVDRIGSEYHELSGRAKDMGSXXXXXXXXXXXXTWCILLWSHFG