[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ecol0:AAC73143.1

[Show Plain Result]


## Summary of Sequence Search
    1::382
    1::382       0.0 100%  382 aa  CARA_ECOLI RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::382       0.0 100%  382 aa  CARA_ECO57 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::382       0.0  99%  382 aa  CARA_ECOL6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::382       0.0  95%  382 aa  CARA_SALTY RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::382       0.0  93%  382 aa  CARA_SALTI RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::381       0.0  87%  391 aa  CARA_YERPS RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::381       0.0  87%  391 aa  CARA_YERPE RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::382       0.0  86%  382 aa  CARA_ERWCT RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::377       0.0  83%  387 aa  CARA_PHOLL RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::378       0.0  81%  379 aa  CARA_VIBCH RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::377     e-180  80%  379 aa  CARA_VIBPA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::375     e-177  79%  384 aa  CARA_PHOPR RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::377     e-177  79%  379 aa  CARA_VIBVU RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::377     e-177  79%  379 aa  CARA_VIBVY RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::386     e-173  76%  386 aa  CARA_SHEON RecName: Full=Carbamoyl-phosphate synthase small chain; 
    6::373     e-156  72%  379 aa  CARA_THISH RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::378     e-155  70%  378 aa  CARA_PSEPK RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::378     e-154  70%  378 aa  CARA_PSEAE RecName: Full=Carbamoyl-phosphate synthase small chain; 
   13::380     e-153  72%  386 aa  CARA_TERTT RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::379     e-153  69%  379 aa  CARA_ACIAD RecName: Full=Carbamoyl-phosphate synthase small chain; 
    9::375     e-151  71%  384 aa  CARA_PSEST RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::381     e-151  68%  381 aa  CARA_HALER RecName: Full=Carbamoyl-phosphate synthase small chain; 
    9::384     e-151  68%  387 aa  CARA_BUCAI RecName: Full=Carbamoyl-phosphate synthase small chain; 
    9::382     e-148  66%  385 aa  CARA_BUCAP RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::378     e-146  67%  378 aa  CARA_PSESM RecName: Full=Carbamoyl-phosphate synthase small chain; 
    8::369     e-145  69%  378 aa  CARA_RALSO RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::368     e-145  68%  377 aa  CARA_NEIMB RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::368     e-145  68%  377 aa  CARA_NEIMA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::385     e-137  64%  389 aa  CARA_HAEDU RecName: Full=Carbamoyl-phosphate synthase small chain; 
   11::397     e-137  63%  397 aa  CARA_POLSQ RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::368     e-136  66%  377 aa  CARA_NEIGO RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::367     e-136  64%  385 aa  CARA_PASMU RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::370     e-134  63%  374 aa  CARA_XYLFA RecName: Full=Carbamoyl-phosphate synthase small chain; 
   11::394     e-133  62%  398 aa  CARA_POLNS RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::370     e-133  63%  374 aa  CARA_XYLFT RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::367     e-133  63%  375 aa  CARA_XANCP RecName: Full=Carbamoyl-phosphate synthase small chain; 
   14::382     e-128  63%  384 aa  CARA_RHOGE RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::387     e-127  60%  391 aa  CARA_XANAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
   14::387     e-121  57%  397 aa  CARA_BUCBP RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::393     e-111  56%  407 aa  CARA_OCHA4 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::398     e-109  55%  407 aa  CARA_BRUSU RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::398     e-109  55%  407 aa  CARA_BRUSI RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::398     e-109  55%  407 aa  CARA_BRUC2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::398     e-109  55%  407 aa  CARA_BRUO2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::398     e-109  55%  407 aa  CARA_BRUME RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::398     e-109  55%  407 aa  CARA_BRUMB RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::398     e-109  55%  407 aa  CARA_BRUAB RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::398     e-109  55%  407 aa  CARA_BRUA2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::398     e-109  55%  407 aa  CARA_BRUA1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   11::389     e-108  56%  398 aa  CARA_RHILO RecName: Full=Carbamoyl-phosphate synthase small chain; 
   16::392     e-108  54%  396 aa  CARA_BRAJA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::373     e-107  53%  374 aa  CARA_ZYMMO RecName: Full=Carbamoyl-phosphate synthase small chain; 
   17::398     e-107  53%  398 aa  CARA_BARQU RecName: Full=Carbamoyl-phosphate synthase small chain; 
   13::391     e-105  53%  401 aa  CARA_RHIME RecName: Full=Carbamoyl-phosphate synthase small chain; 
   17::399     e-105  53%  399 aa  CARA_BARHE RecName: Full=Carbamoyl-phosphate synthase small chain; 
   13::396     e-104  51%  401 aa  CARA_AGRT5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    6::369     e-103  52%  371 aa  CARA_PROA2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    6::365     e-103  52%  366 aa  CARA_CHLTE RecName: Full=Carbamoyl-phosphate synthase small chain; 
   17::396     e-103  52%  398 aa  CARA_BART1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::379     e-103  51%  384 aa  CARA_SYNY3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::383     e-103  53%  389 aa  CARA_RHOBA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::374     e-103  52%  376 aa  CARA_PELCD RecName: Full=Carbamoyl-phosphate synthase small chain; 
   17::395     e-102  53%  399 aa  CARA_BARBK RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::376     e-101  50%  376 aa  CARA_WIGBR RecName: Full=Carbamoyl-phosphate synthase small chain; 
    9::373     e-100  51%  388 aa  CARA_ANASP RecName: Full=Carbamoyl-phosphate synthase small chain; 
   17::388     2e-98  51%  391 aa  CARA_SYNE7 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::376     3e-98  52%  382 aa  CARA_THEEB RecName: Full=Carbamoyl-phosphate synthase small chain; 
   17::388     1e-97  51%  391 aa  CARA_SYNP6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   10::377     4e-97  51%  388 aa  CARA_SILPO RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::370     5e-97  48%  371 aa  CARA_AQUAE RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::383     1e-96  50%  384 aa  CARA_PORPU RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::362     5e-95  50%  363 aa  CARA_LEPIN RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::362     1e-94  49%  363 aa  CARA_LEPIC RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::379     2e-94  48%  383 aa  CARA_SYNPX RecName: Full=Carbamoyl-phosphate synthase small chain; 
   13::381     5e-94  50%  390 aa  CARA_MARMM RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::363     9e-94  51%  372 aa  CARA_AKKM8 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::361     6e-93  50%  363 aa  CARA_LEPBL RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::361     6e-93  50%  363 aa  CARA_LEPBJ RecName: Full=Carbamoyl-phosphate synthase small chain; 
   10::385     2e-92  48%  388 aa  CARA_CAUCR RecName: Full=Carbamoyl-phosphate synthase small chain; 
   13::379     1e-89  48%  380 aa  CARA_STRCO RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::376     1e-88  49%  394 aa  CARA_DEIRA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::376     4e-88  49%  394 aa  CARA_DEIGD RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::357     4e-88  50%  364 aa  CARA_BACCL RecName: Full=Carbamoyl-phosphate synthase
    3::369     5e-88  46%  374 aa  CARA_DESAD RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::392     7e-88  51%  392 aa  CARA_THEMA RecName: Full=Carbamoyl-phosphate synthase small chain; 
   13::379     2e-87  49%  380 aa  CARA_STRAW RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::354     4e-87  51%  366 aa  CARA_OCEIH RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::377     6e-87  46%  382 aa  CARA_SYNR3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    8::384     3e-86  47%  386 aa  CARA_HYPNA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::375     4e-86  45%  378 aa  CARA_HELHP RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::358     7e-86  47%  359 aa  CARA_STRR6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::358     7e-86  47%  359 aa  CARA_STRPN RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::353     1e-85  49%  363 aa  CARA_LISMO RecName: Full=Carbamoyl-phosphate synthase small chain; 
    9::379     1e-85  49%  379 aa  CARA_CORDI RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::359     1e-85  49%  362 aa  CARA_BACHD RecName: Full=Carbamoyl-phosphate synthase
    3::358     1e-85  48%  358 aa  CARA_ARCFU RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::360     3e-85  47%  360 aa  CARA_STRP6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::360     3e-85  47%  360 aa  CARA_STRP3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::360     3e-85  47%  360 aa  CARA_STRP1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::359     6e-85  47%  366 aa  CARA_STAEQ RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::376     6e-85  46%  384 aa  CARA_PORYE RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::360     7e-85  47%  360 aa  CARA_STRP8 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::358     7e-85  47%  366 aa  CARA_STAS1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::359     1e-84  47%  366 aa  CARA_STAHJ RecName: Full=Carbamoyl-phosphate synthase small chain; 
    8::382     3e-84  44%  395 aa  CARA_GRATL RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::355     4e-84  51%  364 aa  CARA_BACSU RecName: Full=Carbamoyl-phosphate synthase
    1::359     5e-84  46%  366 aa  CARA_STAES RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::353     5e-84  48%  363 aa  CARA_LISMF RecName: Full=Carbamoyl-phosphate synthase small chain; 
    6::358     6e-84  49%  358 aa  CARA_FUSNN RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::356     2e-83  49%  365 aa  CARA_BACCR RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::353     2e-83  49%  363 aa  CARA_LISIN RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::355     4e-83  49%  363 aa  CARA_SYMTH RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::356     4e-83  46%  362 aa  CARA_STRMU RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::356     7e-83  46%  358 aa  CARA_STRA5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::356     7e-83  46%  358 aa  CARA_STRA3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::346     3e-82  49%  349 aa  CARA_CLOPE RecName: Full=Carbamoyl-phosphate synthase small chain; 
    8::373     8e-82  46%  391 aa  CARA_THET8 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    8::373     8e-82  46%  391 aa  CARA_THET2 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::359     8e-82  49%  366 aa  CARA_STAAW RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::359     8e-82  49%  366 aa  CARA_STAAS RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::359     8e-82  49%  366 aa  CARA_STAAR RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::359     8e-82  49%  366 aa  CARA_STAAN RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::359     8e-82  49%  366 aa  CARA_STAAM RecName: Full=Carbamoyl-phosphate synthase small chain; 
    7::359     8e-82  49%  366 aa  CARA_STAAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::356     5e-81  49%  365 aa  CARA_BACHK RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::356     5e-81  49%  365 aa  CARA_BACAN RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::361     6e-81  45%  361 aa  CARA_METKA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::351     6e-81  45%  351 aa  CARA_CLOAB RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::358     8e-81  45%  364 aa  CARA_LACPL RecName: Full=Carbamoyl-phosphate synthase
    5::356     8e-81  49%  365 aa  CARA_BACC1 RecName: Full=Carbamoyl-phosphate synthase small chain; 
   24::397     1e-80  46%  400 aa  CARA_COREF RecName: Full=Carbamoyl-phosphate synthase small chain; 
   19::407     1e-80  46%  407 aa  CARA_BIFLI RecName: Full=Carbamoyl-phosphate synthase small chain; 
   19::407     1e-80  46%  407 aa  CARA_BIFLO RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::356     2e-80  48%  365 aa  CARA_BACCZ RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::349     3e-80  48%  356 aa  CARA_THETN RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::371     3e-80  49%  376 aa  CARA_MYCTU RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::371     4e-80  49%  376 aa  CARA_MYCBO RecName: Full=Carbamoyl-phosphate synthase small chain; 
   19::407     5e-80  46%  407 aa  CARA_BIFLD RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::342     9e-80  46%  357 aa  CARA_LACLM RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::342     1e-79  46%  357 aa  CARA_LACLA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::356     2e-79  46%  366 aa  CARA_METM7 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::356     3e-79  46%  366 aa  CARA_METMP RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::371     6e-79  44%  375 aa  CARA_DESMR RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::356     2e-78  45%  366 aa  CARA_METM5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::371     2e-78  43%  375 aa  CARA_DESVV RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::371     2e-78  43%  375 aa  CARA_DESVH RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::356     3e-78  45%  366 aa  CARA_METM6 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::350     9e-78  46%  354 aa  CARA_METJA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::370     3e-77  47%  373 aa  CARA_MYCPA RecName: Full=Carbamoyl-phosphate synthase small chain; 
   18::393     1e-76  44%  399 aa  CARA_CYACA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::356     2e-76  44%  368 aa  CARA_METAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::356     3e-76  44%  368 aa  CARA_METMA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::370     3e-76  46%  376 aa  CARA_DESDA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::372     1e-75  43%  376 aa  CARA_DESVM RecName: Full=Carbamoyl-phosphate synthase small chain; 
   19::385     1e-75  46%  393 aa  CARA_CORGL RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::375     2e-75  46%  375 aa  CARA_MYCLE RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::368     3e-74  44%  369 aa  CARA_METVS RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::375     1e-73  42%  379 aa  CARA_HELAH RecName: Full=Carbamoyl-phosphate synthase small chain; 
    4::375     2e-73  41%  375 aa  CARA_HELPJ RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::351     2e-72  44%  356 aa  CARA_METTH RecName: Full=Carbamoyl-phosphate synthase small chain; 
    3::370     1e-71  43%  376 aa  CARA_LAWIP RecName: Full=Carbamoyl-phosphate synthase small chain; 
   62::429     4e-71  42%  461 aa  CARA_CHAGB RecName: Full=Carbamoyl-phosphate synthase
    4::375     2e-70  40%  375 aa  CARA_HELPY RecName: Full=Carbamoyl-phosphate synthase small chain; 
   59::422     4e-70  43%  453 aa  CARA_NEUCR RecName: Full=Carbamoyl-phosphate synthase
    3::372     7e-70  40%  372 aa  CARA_CAMJE RecName: Full=Carbamoyl-phosphate synthase small chain; 
   41::404     4e-68  40%  453 aa  CARA_ASPNC RecName: Full=Carbamoyl-phosphate synthase
   36::406     8e-68  43%  429 aa  CARA_DEBHA RecName: Full=Carbamoyl-phosphate synthase
   42::405     1e-67  40%  450 aa  CARA_ASPOR RecName: Full=Carbamoyl-phosphate synthase
   46::412     3e-67  41%  415 aa  CARA_SCHPO RecName: Full=Carbamoyl-phosphate synthase
    3::346     7e-67  41%  354 aa  CARX_BACST RecName: Full=Carbamoyl-phosphate synthase
   29::387     2e-66  43%  409 aa  CARA_KLULA RecName: Full=Carbamoyl-phosphate synthase
   37::407     8e-66  42%  430 aa  CARA_CANAL RecName: Full=Carbamoyl-phosphate synthase
    2::359     1e-65  44% 2225 aa  PYR1_HUMAN RecName: Full=CAD protein;Includes:  RecName:
   55::412     1e-65  42%  453 aa  CARA_TRIVE RecName: Full=Carbamoyl-phosphate synthase
    3::347     1e-65  41%  359 aa  CARX_BACHD RecName: Full=Carbamoyl-phosphate synthase
    8::374     6e-65  43%  411 aa  CARA_YEAST RecName: Full=Carbamoyl-phosphate synthase
   46::417     1e-64  39%  448 aa  CARA_YARLI RecName: Full=Carbamoyl-phosphate synthase
    2::355     1e-64  44% 2242 aa  PYR1_SQUAC RecName: Full=CAD protein;Includes:  RecName:
    2::359     3e-64  44% 2225 aa  PYR1_MESAU RecName: Full=CAD protein;Includes:  RecName:
    5::348     2e-63  40%  353 aa  CARX_BACSU RecName: Full=Carbamoyl-phosphate synthase
   62::448     2e-63  41% 2275 aa  PYR1_EMENI RecName: Full=Protein pyrABCN;Includes:  RecName:
   57::445     3e-63  40% 2244 aa  PYR1_SCHPO RecName: Full=Protein ura1;Includes:  RecName:
    1::344     3e-63  41%  346 aa  CARA_PYRAE RecName: Full=Carbamoyl-phosphate synthase small chain; 
   47::413     5e-63  38%  476 aa  CARA_PHANO RecName: Full=Carbamoyl-phosphate synthase
   44::404     8e-63  42% 1500 aa  CPSM_HUMAN RecName: Full=Carbamoyl-phosphate synthase [ammonia],
    5::349     1e-62  40%  355 aa  CARX_LACPL RecName: Full=Carbamoyl-phosphate synthase
    8::376     3e-62  44% 2224 aa  PYR1_DROME RecName: Full=CAD protein;AltName: Full=Protein
    7::390     4e-62  40% 2225 aa  PYR1_DICDI RecName: Full=Protein PYR1-3;Includes:  RecName:
   44::404     1e-61  42% 1500 aa  CPSM_MOUSE RecName: Full=Carbamoyl-phosphate synthase [ammonia],
    1::368     1e-61  42%  392 aa  CARA_CANGA RecName: Full=Carbamoyl-phosphate synthase
   44::404     2e-61  42% 1500 aa  CPSM_RAT RecName: Full=Carbamoyl-phosphate synthase [ammonia],
   41::404     6e-61  38%  453 aa  CARA_NEOFI RecName: Full=Carbamoyl-phosphate synthase
   41::404     6e-61  38%  453 aa  CARA_ASPFU RecName: Full=Carbamoyl-phosphate synthase
   24::413     3e-60  42% 2214 aa  PYR1_YEAST RecName: Full=Protein URA1;Includes:  RecName:
   47::412     3e-60  37%  468 aa  CARA_COCIM RecName: Full=Carbamoyl-phosphate synthase
   41::404     3e-60  38%  455 aa  CARA_ASPCL RecName: Full=Carbamoyl-phosphate synthase
   39::401     3e-59  41% 1496 aa  CPSM_RANCA RecName: Full=Carbamoyl-phosphate synthase [ammonia],
    7::378     4e-59  39%  399 aa  CARA_ASHGO RecName: Full=Carbamoyl-phosphate synthase
    1::344     9e-59  39%  353 aa  CARA_HALSA RecName: Full=Carbamoyl-phosphate synthase small chain; 
    1::344     9e-59  39%  353 aa  CARA_HALS3 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    6::364     7e-56  38%  367 aa  CARA_SULSO RecName: Full=Carbamoyl-phosphate synthase small chain; 
   14::367     7e-54  39%  371 aa  CARA_SULAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
   11::366     7e-54  34%  372 aa  CARA_METS5 RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::368     3e-53  36%  371 aa  CARA_PYRFU RecName: Full=Carbamoyl-phosphate synthase small chain; 
   38::369     1e-51  39%  417 aa  CARA_EMENI RecName: Full=Carbamoyl-phosphate synthase
   13::370     1e-50  35%  372 aa  CARA_SULTO RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::335     3e-49  41%  345 aa  CARA_THEVO RecName: Full=Carbamoyl-phosphate synthase small chain; 
    5::347     6e-47  39%  348 aa  CARA_THEAC RecName: Full=Carbamoyl-phosphate synthase small chain; 
   80::218     1e-17  34%  589 aa  TRPG_THEMA RecName: Full=Anthranilate synthase component II;       
   24::168     7e-17  35%  192 aa  TRPG_PYRKO RecName: Full=Anthranilate synthase component II;       
   18::192     1e-16  29%  197 aa  TRPG_METJA RecName: Full=Anthranilate synthase component II;       
  552::700     1e-15  34%  729 aa  TRPE_RHIME RecName: Full=Anthranilate synthase;       
   14::177     1e-14  30%  196 aa  TRPG_AZOBR RecName: Full=Anthranilate synthase component 2;        
   36::170     2e-13  35%  190 aa  TRPG2_HALMA RecName: Full=Anthranilate synthase component II;      
   14::171     3e-13  28%  194 aa  PABA_BACSU RecName: Full=Para-aminobenzoate/anthranilate synthase
   19::189     1e-12  31%  189 aa  GUAAA_METBF RecName: Full=GMP synthase [glutamine-hydrolyzing]
   39::172     2e-12  32%  189 aa  TRPG_PORPU RecName: Full=Anthranilate synthase component II;       
   19::187     2e-12  36%  189 aa  GUAAA_UNCMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::186     2e-12  31%  186 aa  GUAAA_METST RecName: Full=GMP synthase [glutamine-hydrolyzing]
   19::189     2e-12  33%  189 aa  GUAAA_METBU RecName: Full=GMP synthase [glutamine-hydrolyzing]
   39::172     5e-12  28%  189 aa  TRPG_PORYE RecName: Full=Anthranilate synthase component II;       
   43::195     5e-12  28%  198 aa  TRPG_LACLA RecName: Full=Anthranilate synthase component II;       
    6::177     5e-12  32%  512 aa  GUAA_FUSNN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::171     6e-12  33%  187 aa  PABA_KLEAE RecName: Full=Para-aminobenzoate synthase glutamine
   33::192     8e-12  29%  194 aa  TRPG_ACIAD RecName: Full=Anthranilate synthase component 2;        
   21::191     1e-11  31%  535 aa  GUAA_BIFLO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   47::188     2e-11  37%  723 aa  PABS_STRGR RecName: Full=Para-aminobenzoate synthase;       
    6::171     2e-11  31%  510 aa  GUAA_ALKMQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   35::178     3e-11  31%  195 aa  TRPG_SULSO RecName: Full=Anthranilate synthase component II;       
   24::172     3e-11  32%  190 aa  TRPG_CYAPA RecName: Full=Anthranilate synthase component II;       
   11::177     5e-11  32%  516 aa  GUAA_LACAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   26::184     7e-11  28%  484 aa  TRPG_YEAST RecName: Full=Anthranilate synthase component 2;        
   12::178     9e-11  32%  517 aa  GUAA_LACRJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::178     9e-11  32%  517 aa  GUAA_LACRD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::178     9e-11  31%  517 aa  GUAA_LACGA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::176     9e-11  27%  510 aa  GUAA_CLOK5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::176     9e-11  27%  510 aa  GUAA_CLOK1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   15::177     1e-10  28%  198 aa  TRPG_PSEPU RecName: Full=Anthranilate synthase component II;       
   42::171     1e-10  33%  187 aa  PABA_SALTY RecName: Full=Para-aminobenzoate synthase glutamine
   10::181     1e-10  29%  521 aa  GUAA_RUTMC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::179     1e-10  32%  512 aa  GUAA_BACC2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::186     2e-10  32%  526 aa  GUAA_THICR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::179     2e-10  31%  518 aa  GUAA_LISMO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::189     2e-10  31%  189 aa  GUAAA_METAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
   44::199     2e-10  34%  201 aa  TRPG_LEPBI RecName: Full=Anthranilate synthase component II;       
   10::175     2e-10  30%  514 aa  GUAA_LISMF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::179     2e-10  30%  512 aa  GUAA_BACCN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::194     3e-10  31%  520 aa  GUAA_WOLWR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::194     3e-10  31%  520 aa  GUAA_WOLPM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::172     3e-10  33%  511 aa  GUAA_OCEIH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::108     3e-10  34%  511 aa  GUAA_CALS8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::98      3e-10  39%  513 aa  GUAA_BACSU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::182     3e-10  32%  515 aa  GUAA_BACCR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   33::176     3e-10  30%  201 aa  TRPG_PSEAE RecName: Full=Anthranilate synthase component II;       
   36::216     3e-10  28%  752 aa  TRPG_PENCH RecName: Full=Anthranilate synthase component 2;        
   38::175     3e-10  30%  191 aa  PABA_SERMA RecName: Full=Para-aminobenzoate synthase glutamine
   14::181     3e-10  35%  520 aa  GUAA_STRZP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::181     3e-10  33%  524 aa  GUAA_CORAM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::98      3e-10  39%  513 aa  GUAA_BACLD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::179     3e-10  32%  512 aa  GUAA_BACC4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::178     5e-10  32%  517 aa  GUAA_STRMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::179     5e-10  29%  518 aa  GUAA_LISIN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::173     5e-10  31%  188 aa  GUAAA_PYRAB RecName: Full=GMP synthase [glutamine-hydrolyzing]
    6::113     6e-10  33%  511 aa  GUAA_ANATD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::172     8e-10  32%  513 aa  GUAA_SULNB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::178     8e-10  29%  517 aa  GUAA_LACJO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::192     8e-10  33%  523 aa  GUAA_CORGL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::192     8e-10  33%  523 aa  GUAA_CORGB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::107     8e-10  37%  512 aa  GUAA_CLONN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::171     8e-10  31%  513 aa  GUAA_CLOBA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::179     8e-10  31%  512 aa  GUAA_BACWK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::174     8e-10  30%  513 aa  GUAA_BACA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::167     1e-09  35%  503 aa  GUAA_TROWT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRZT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRZJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRR6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRPN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRPI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRP4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::181     1e-09  34%  520 aa  GUAA_STRP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::184     1e-09  31%  525 aa  GUAA_LEGPL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::184     1e-09  31%  525 aa  GUAA_LEGPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::184     1e-09  30%  505 aa  GUAA_DEIGD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::179     1e-09  30%  512 aa  GUAA_BACC1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   48::173     1e-09  35%  193 aa  TRPG_HAEIN RecName: Full=Anthranilate synthase component II;       
   14::194     1e-09  30%  528 aa  GUAA_THEFY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::175     2e-09  32%  516 aa  GUAA_SULDN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::177     2e-09  34%  516 aa  GUAA_NITSB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::92      2e-09  38%  189 aa  GUAAA_PYRHO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   19::189     2e-09  30%  189 aa  GUAAA_METMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   13::184     2e-09  30%  525 aa  GUAA_LEGPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::114     2e-09  33%  517 aa  GUAA_LACDB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::114     2e-09  33%  517 aa  GUAA_LACDA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::181     2e-09  30%  539 aa  GUAA_JANMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     3e-09  36%  522 aa  GUAA_XYLFT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     3e-09  36%  522 aa  GUAA_XYLFM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     3e-09  36%  522 aa  GUAA_XYLF2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     3e-09  28%  520 aa  GUAA_STRA5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     3e-09  28%  520 aa  GUAA_STRA3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     3e-09  28%  520 aa  GUAA_STRA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::193     3e-09  31%  520 aa  GUAA_RHIEC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::103     3e-09  39%  510 aa  GUAA_ELUMP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::105     3e-09  38%  513 aa  GUAA_CLOBB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::190     3e-09  28%  528 aa  GUAA_BORGA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::182     3e-09  30%  515 aa  GUAA_BACHK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::182     3e-09  30%  515 aa  GUAA_BACCZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::182     3e-09  30%  515 aa  GUAA_BACC3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::179     3e-09  30%  512 aa  GUAA_BACC0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::179     3e-09  30%  512 aa  GUAA_BACAN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::182     3e-09  30%  515 aa  GUAA_BACAH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::182     3e-09  30%  515 aa  GUAA_BACAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   11::182     3e-09  30%  515 aa  GUAA_BACAA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::184     3e-09  28%  188 aa  GUAAA_PYRKO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   26::171     4e-09  31%  187 aa  PABA_ECOLI RecName: Full=Para-aminobenzoate synthase glutamine
    4::167     4e-09  34%  503 aa  GUAA_TROW8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::196     4e-09  31%  520 aa  GUAA_RHIE6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::105     5e-09  36%  510 aa  GUAA_CLOTE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   15::173     7e-09  25%  765 aa  TRPG_PHYBL RecName: Full=Anthranilate synthase component 2;        
    2::109     7e-09  35%  513 aa  GUAA_STAAW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAAT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAAS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAAN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAAM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAA9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAA8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAA3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     7e-09  35%  513 aa  GUAA_STAA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   46::263     7e-09  28%  587 aa  GUAA_RHOBA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::171     7e-09  31%  524 aa  GUAA_EUBE2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::171     7e-09  30%  511 aa  GUAA_ARCB4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::178     7e-09  26%  181 aa  GUAAA_METTP RecName: Full=GMP synthase [glutamine-hydrolyzing]
   27::174     9e-09  34%  178 aa  TRPG_ARCFU RecName: Full=Anthranilate synthase component 2;        
    8::175     9e-09  30%  512 aa  GUAA_THETN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::104     9e-09  38%  513 aa  GUAA_THEAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::196     9e-09  30%  520 aa  GUAA_RHISN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::196     9e-09  31%  520 aa  GUAA_RHILW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::187     9e-09  30%  539 aa  GUAA_MICLC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::181     9e-09  31%  539 aa  GUAA_HERAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::103     9e-09  38%  514 aa  GUAA_CHLT3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  536::702     1e-08  28%  732 aa  TRPE_AZOBR RecName: Full=Anthranilate synthase;       
   13::181     1e-08  30%  520 aa  GUAA_STRPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::180     1e-08  34%  528 aa  GUAA_PROM5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::179     1e-08  29%  518 aa  GUAA_LISW6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::189     1e-08  29%  511 aa  GUAA_DEIDV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     1e-08  34%  524 aa  GUAA_COXBU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     1e-08  34%  524 aa  GUAA_COXBR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     1e-08  34%  524 aa  GUAA_COXB2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     1e-08  34%  524 aa  GUAA_COXB1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::180     1e-08  32%  523 aa  GUAA_COREF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   38::201     1e-08  30%  762 aa  TRPG_NEUCR RecName: Full=Anthranilate synthase component 2;        
   46::184     1e-08  31%  196 aa  TRPG_METTH RecName: Full=Anthranilate synthase component II;       
   10::110     1e-08  35%  522 aa  GUAA_XYLFA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   15::180     1e-08  31%  521 aa  GUAA_WOLSU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     1e-08  30%  520 aa  GUAA_STRU0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::188     1e-08  33%  527 aa  GUAA_STRT2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::188     1e-08  33%  527 aa  GUAA_STRT1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     1e-08  34%  513 aa  GUAA_STAES RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     1e-08  34%  513 aa  GUAA_STAEQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::150     1e-08  34%  510 aa  GUAA_GEOKA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::182     1e-08  34%  525 aa  GUAA_CORDI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::175     1e-08  31%  509 aa  GUAA_CARHZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   41::183     1e-08  30%  183 aa  GUAAA_HALSA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   38::202     2e-08  27%  770 aa  TRPG_ASPNG RecName: Full=Anthranilate synthase component 2;        
    4::191     2e-08  27%  513 aa  GUAA_THEM4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     2e-08  33%  513 aa  GUAA_STACT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   30::216     2e-08  31%  540 aa  GUAA_RHOPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::84      2e-08  38%  508 aa  GUAA_HELAH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   18::185     2e-08  31%  529 aa  GUAA_CORJK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::176     2e-08  32%  511 aa  GUAA_CLOCE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::173     2e-08  34%  510 aa  GUAA_CAMFF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::98      2e-08  35%  513 aa  GUAA_BACP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::196     2e-08  29%  520 aa  GUAA_AGRVS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::196     2e-08  26%  196 aa  TRPG_METTM RecName: Full=Anthranilate synthase component II;       
   13::181     2e-08  30%  520 aa  GUAA_STRPZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-08  30%  520 aa  GUAA_STRPM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-08  30%  520 aa  GUAA_STRPF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-08  30%  520 aa  GUAA_STRPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-08  30%  520 aa  GUAA_STRPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-08  30%  520 aa  GUAA_STRPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-08  30%  520 aa  GUAA_STRP8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-08  30%  520 aa  GUAA_STRP6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-08  30%  520 aa  GUAA_STRP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::194     2e-08  30%  525 aa  GUAA_STRAW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     2e-08  32%  513 aa  GUAA_STAS1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   30::125     2e-08  36%  540 aa  GUAA_RHOP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::180     2e-08  33%  528 aa  GUAA_PROMP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   27::126     2e-08  37%  540 aa  GUAA_NOSP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::184     2e-08  28%  525 aa  GUAA_LEGPH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   49::184     3e-08  26%  204 aa  TRPG_THET8 RecName: Full=Anthranilate synthase component II;       
   13::181     3e-08  30%  520 aa  GUAA_STRP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::211     3e-08  32%  540 aa  GUAA_NITHX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::196     3e-08  30%  520 aa  GUAA_AGRRK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   18::184     3e-08  33%  188 aa  GUAAA_PICTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
   38::218     4e-08  25%  768 aa  TRPG_EMENI RecName: Full=Anthranilate synthase component 2;        
   50::198     4e-08  32%  718 aa  PABS_SCHPO RecName: Full=Putative aminodeoxychorismate synthase;   
    4::194     4e-08  27%  520 aa  GUAA_WOLPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     4e-08  34%  513 aa  GUAA_STAAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::180     4e-08  26%  513 aa  GUAA_LACLS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::180     4e-08  26%  513 aa  GUAA_LACLM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::118     4e-08  29%  511 aa  GUAA_CAMHC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::167     4e-08  33%  184 aa  GUAAA_HALWD RecName: Full=GMP synthase [glutamine-hydrolyzing]
    4::194     6e-08  27%  520 aa  GUAA_WOLTR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   22::187     6e-08  33%  535 aa  GUAA_THEEB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::180     6e-08  33%  528 aa  GUAA_PROM0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     6e-08  33%  524 aa  GUAA_COXBN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::122     6e-08  36%  509 aa  GUAA_CLOPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::105     6e-08  35%  510 aa  GUAA_CLOB8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   27::126     6e-08  35%  540 aa  GUAA_ANAVT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   43::190     7e-08  30%  207 aa  TRPG1_HALMA RecName: Full=Anthranilate synthase component II;      
    2::109     7e-08  32%  513 aa  GUAA_STAHJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::180     7e-08  31%  526 aa  GUAA_SALRD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::196     7e-08  30%  520 aa  GUAA_RHIME RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::180     7e-08  34%  528 aa  GUAA_PROMS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::109     7e-08  31%  513 aa  GUAA_MACCJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::101     7e-08  37%  508 aa  GUAA_HELPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::171     7e-08  29%  524 aa  GUAA_EUBR3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::102     7e-08  34%  520 aa  GUAA_ENTFA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::176     7e-08  29%  515 aa  GUAA_DESAD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   29::194     7e-08  30%  542 aa  GUAA_CYAP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::108     7e-08  38%  513 aa  GUAA_BACHD RecName: Full=Putative GMP synthase
   65::193     7e-08  30%  202 aa  GUAAA_THEVO RecName: Full=GMP synthase [glutamine-hydrolyzing]
    2::91      7e-08  34%  188 aa  GUAAA_PYRFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    5::183     7e-08  32%  183 aa  GUAAA_ARCFU RecName: Full=GMP synthase [glutamine-hydrolyzing]
    7::105     9e-08  32%  520 aa  GUAA_RHIL3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::177     9e-08  34%  514 aa  GUAA_CHLPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::195     9e-08  30%  518 aa  GUAA_BARQU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::108     9e-08  39%  515 aa  GUAA_BACSK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   16::93      1e-07  37%  208 aa  TRPG_CORGL RecName: Full=Anthranilate synthase component 2;        
    7::196     1e-07  30%  520 aa  GUAA_SINMW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::186     1e-07  34%  528 aa  GUAA_PROMT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::112     1e-07  31%  517 aa  GUAA_PEDPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::84      1e-07  37%  508 aa  GUAA_HELPY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::90      1e-07  40%  506 aa  GUAA_DEIRA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      1e-07  45%  510 aa  GUAA_CLOBL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      1e-07  45%  510 aa  GUAA_CLOBK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      1e-07  45%  510 aa  GUAA_CLOBJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      1e-07  45%  510 aa  GUAA_CLOBH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      1e-07  45%  510 aa  GUAA_CLOB6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      1e-07  45%  510 aa  GUAA_CLOB1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::105     1e-07  33%  511 aa  GUAA_CAMLR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   30::90      1e-07  34%  186 aa  GUAAA_METTH RecName: Full=GMP synthase [glutamine-hydrolyzing]
   14::186     2e-07  34%  528 aa  GUAA_PROM1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::180     2e-07  26%  513 aa  GUAA_LACLA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   15::199     2e-07  29%  526 aa  GUAA_ZYMMO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-07  28%  520 aa  GUAA_STRS7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::181     2e-07  28%  520 aa  GUAA_STRE4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::84      2e-07  36%  508 aa  GUAA_HELPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::84      2e-07  36%  508 aa  GUAA_HELPH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::100     2e-07  34% 1375 aa  GUAA_HELHP RecName: Full=Probable GMP synthase
    7::174     2e-07  31%  515 aa  GUAA_DESVM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   29::128     2e-07  37%  542 aa  GUAA_CYAA5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      2e-07  41%  510 aa  GUAA_CLOBM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      2e-07  35%  511 aa  GUAA_CAMJE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   27::126     2e-07  34%  540 aa  GUAA_ANASP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   40::195     3e-07  30%  526 aa  GUAA_STRCO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::95      3e-07  34%  518 aa  GUAA_LACS1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::197     3e-07  26%  533 aa  GUAA_DEHSC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      3e-07  34%  511 aa  GUAA_CAMJR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   23::190     3e-07  25%  528 aa  GUAA_BORBU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::170     3e-07  30%  506 aa  GUAA_BDEBA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::199     3e-07  32%  557 aa  GUAA_ASPFU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::183     3e-07  30%  523 aa  GUAA_ALCBS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   20::178     4e-07  25%  367 aa  TRPG_PICAN RecName: Full=Anthranilate synthase component 2;        
   40::91      4e-07  46%   91 aa  TRPG_CLOTM RecName: Full=Anthranilate synthase component 2;        
   10::165     4e-07  30%  503 aa  GUAA_LEIXX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::111     4e-07  31%  511 aa  GUAA_CLOD6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      4e-07  35%  511 aa  GUAA_CAMJJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      4e-07  35%  511 aa  GUAA_CAMJD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   35::173     5e-07  27%  196 aa  TRPG_VIBPA RecName: Full=Anthranilate synthase component II;       
   10::110     5e-07  31%  517 aa  GUAA_VIBSL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::180     5e-07  34%  528 aa  GUAA_PROM9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::109     5e-07  30%  511 aa  GUAA_MYCPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::101     5e-07  39%  516 aa  GUAA_MOOTA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::99      5e-07  31%  517 aa  GUAA_LACSS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::89      5e-07  34%  511 aa  GUAA_CAMJ8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::198     5e-07  29%  525 aa  GUAA_ASHGO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      5e-07  31%  525 aa  GUAA_AGRT5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::167     5e-07  31%  188 aa  GUAAA_METJA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   35::173     6e-07  30%  531 aa  TRPG_ECOLI RecName: Full=Anthranilate synthase component II;       
   55::200     6e-07  27%  768 aa  TRPG_ASPAW RecName: Full=Anthranilate synthase component 2;        
    6::105     6e-07  34%  510 aa  GUAA_SYNWW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::196     6e-07  27%  520 aa  GUAA_RHILO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::180     6e-07  31%  528 aa  GUAA_PROMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::101     6e-07  37%  527 aa  GUAA_PHOPR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::198     6e-07  28%  522 aa  GUAA_NITMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::84      6e-07  36%  508 aa  GUAA_HELPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::173     6e-07  28%  510 aa  GUAA_AQUAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   35::173     8e-07  30%  201 aa  TRPG_SHIDY RecName: Full=Anthranilate synthase component II;       
   10::110     8e-07  30%  517 aa  GUAA_VIBFM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     8e-07  30%  517 aa  GUAA_VIBF1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   29::128     8e-07  33%  542 aa  GUAA_SYNY3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::116     8e-07  31%  529 aa  GUAA_MYCLE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::116     8e-07  31%  529 aa  GUAA_MYCLB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::179     8e-07  25%  518 aa  GUAA_LACPL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::84      8e-07  36%  508 aa  GUAA_HELP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::106     8e-07  34%  515 aa  GUAA_DESVV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::106     8e-07  34%  515 aa  GUAA_DESVH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::175     8e-07  32%  516 aa  GUAA_DESPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     8e-07  30%  517 aa  GUAA_ALISL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::177     1e-06  28%  517 aa  GUAA_VIBHB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::132     1e-06  34%  527 aa  GUAA_THERP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::180     1e-06  31%  528 aa  GUAA_PROM2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::106     1e-06  37%  510 aa  GUAA_HALOH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::90      1e-06  42%  516 aa  GUAA_DESDG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::126     1e-06  29%  533 aa  GUAA_DEHE1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::105     1e-06  34%  511 aa  GUAA_CLOTH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::120     1e-06  33%  535 aa  GUAA_BRASO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   15::87      1e-06  45%  189 aa  GUAAA_METM7 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   14::101     1e-06  42%  528 aa  GUAA_SYNPX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::203     1e-06  29%  529 aa  GUAA_AERHH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   15::171     1e-06  33%  189 aa  GUAAA_METVS RecName: Full=GMP synthase [glutamine-hydrolyzing]
   42::176     2e-06  31%  195 aa  TRPG_CYACA RecName: Full=Anthranilate synthase component II;       
   14::114     2e-06  34%  528 aa  GUAA_SYNSC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::114     2e-06  39%  528 aa  GUAA_SYNS9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     2e-06  34%  539 aa  GUAA_RALEJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::139     2e-06  37%  524 aa  GUAA_NOCFA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  108::290     2e-06  28%  792 aa  GUAA_CAEEL RecName: Full=Probable GMP synthase
    9::98      2e-06  32%  518 aa  GUAA_BARHE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   40::129     2e-06  33%  550 aa  GUAA_ACIAD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      2e-06  31%  517 aa  GUAA_VIBVY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      2e-06  31%  517 aa  GUAA_VIBVU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     2e-06  29%  517 aa  GUAA_VIBCM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     2e-06  29%  517 aa  GUAA_VIBCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     2e-06  29%  517 aa  GUAA_VIBC3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::103     2e-06  35%  513 aa  GUAA_PELPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::116     2e-06  32%  531 aa  GUAA_OLICO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::186     2e-06  28%  526 aa  GUAA_HAHCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::173     2e-06  26%  510 aa  GUAA_FINM2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     2e-06  36%  526 aa  GUAA_AERS4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   16::180     3e-06  26%  192 aa  TRPG_YERPE RecName: Full=Anthranilate synthase component II;       
  361::543     3e-06  35%  543 aa  PYRG_PSEF5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::110     3e-06  31%  525 aa  GUAA_TOLAT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::173     3e-06  28%  512 aa  GUAA_SPIKU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::172     3e-06  28%  525 aa  GUAA_PSEA6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   25::211     3e-06  30%  535 aa  GUAA_NITWN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::176     3e-06  28%  510 aa  GUAA_NATTJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::198     3e-06  27%  512 aa  GUAA_CHLCV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   35::173     4e-06  28%  531 aa  TRPG_SALTY RecName: Full=Anthranilate synthase component II;       
   41::181     4e-06  26%  204 aa  TRPG_HALVO RecName: Full=Anthranilate synthase component II;       
   10::97      4e-06  30%  521 aa  GUAA_VESOH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      4e-06  33%  525 aa  GUAA_PSEAE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      4e-06  33%  525 aa  GUAA_PSEAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      4e-06  33%  525 aa  GUAA_PSEA8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::116     4e-06  34%  525 aa  GUAA_MYCMM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::99      4e-06  30%  517 aa  GUAA_LACRH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::99      4e-06  30%  517 aa  GUAA_LACCB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   12::99      4e-06  30%  517 aa  GUAA_LACC3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      4e-06  30%  525 aa  GUAA_ENT38 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    3::198     4e-06  27%  512 aa  GUAA_CHLMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   64::195     4e-06  29%  200 aa  GUAAA_THEAC RecName: Full=GMP synthase [glutamine-hydrolyzing]
  361::543     5e-06  34%  543 aa  PYRG_PSEPF RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::110     5e-06  29%  517 aa  GUAA_VIBPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     5e-06  31%  520 aa  GUAA_THIDA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::183     5e-06  31%  503 aa  GUAA_THET8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::183     5e-06  31%  503 aa  GUAA_THET2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      5e-06  29%  525 aa  GUAA_SALTY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::198     5e-06  27%  512 aa  GUAA_CHLFF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::185     5e-06  28%  525 aa  GUAA_BLOPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::118     7e-06  32%  523 aa  GUAA_TREDE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      7e-06  34%  527 aa  GUAA_BURP8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  33%  521 aa  GUAA_XANOR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  33%  521 aa  GUAA_XANOP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  33%  521 aa  GUAA_XANOM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  33%  521 aa  GUAA_XANCP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  33%  521 aa  GUAA_XANCB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  33%  521 aa  GUAA_XANC8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  33%  521 aa  GUAA_XANC5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  33%  521 aa  GUAA_XANAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  32%  521 aa  GUAA_STRMK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::109     9e-06  32%  521 aa  GUAA_STRM5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::103     9e-06  34%  513 aa  GUAA_PROVI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::180     9e-06  25%  528 aa  GUAA_PROM3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::120     9e-06  31%  530 aa  GUAA_PROAC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     9e-06  32%  525 aa  GUAA_PHOLL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      9e-06  31%  520 aa  GUAA_PHEZH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     9e-06  36%  520 aa  GUAA_PELPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     9e-06  34%  525 aa  GUAA_ALTMD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::89      9e-06  43%  189 aa  GUAAA_METMP RecName: Full=GMP synthase [glutamine-hydrolyzing]
   10::185     1e-05  30%  525 aa  GUAA_YERPY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::185     1e-05  30%  525 aa  GUAA_YERPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::185     1e-05  30%  525 aa  GUAA_YERPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::185     1e-05  30%  525 aa  GUAA_YERPN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::185     1e-05  30%  525 aa  GUAA_YERPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::185     1e-05  30%  525 aa  GUAA_YERPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::185     1e-05  30%  525 aa  GUAA_YERPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::185     1e-05  30%  525 aa  GUAA_YERPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::185     1e-05  30%  525 aa  GUAA_YERP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      1e-05  33%  525 aa  GUAA_YERE8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      1e-05  29%  525 aa  GUAA_SALAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      1e-05  29%  525 aa  GUAA_KLEP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      1e-05  29%  525 aa  GUAA_KLEP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   18::176     1e-05  32%  522 aa  GUAA_GIBZE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::176     1e-05  25%  516 aa  GUAA_FRATW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::186     1e-05  27%  510 aa  GUAA_CLOAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::103     1e-05  33%  513 aa  GUAA_CHLL2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::87      1e-05  44%  189 aa  GUAAA_METM6 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   10::99      2e-05  33%  525 aa  GUAA_SERP5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::180     2e-05  29%  539 aa  GUAA_RALME RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::197     2e-05  27%  525 aa  GUAA_PSEHT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::118     2e-05  30%  523 aa  GUAA_PASMU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::162     2e-05  28%  525 aa  GUAA_IDILO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::176     2e-05  25%  516 aa  GUAA_FRATT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::176     2e-05  25%  516 aa  GUAA_FRAT1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    2::109     2e-05  30%  514 aa  GUAA_EXIS2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  30%  525 aa  GUAA_ESCF3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  30%  525 aa  GUAA_ECO27 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::173     2e-05  26%  514 aa  GUAA_BRAHW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::154     2e-05  22%  526 aa  GUAA_BLOFL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   28::167     2e-05  30%  189 aa  GUAAA_METM5 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   42::171     2e-05  26%  193 aa  Y1171_HAEIN RecName: Full=Putative anthranilate synthase component
   16::97      2e-05  33%  193 aa  TRPG_SERMA RecName: Full=Anthranilate synthase component II;       
   10::97      2e-05  29%  525 aa  GUAA_SHISS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SHIDS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SHIBS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SHIB3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALTI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALSV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALPK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALNS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALHS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALG2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALEP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALDC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_SALA4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      2e-05  31%  525 aa  GUAA_PSEPK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      2e-05  31%  525 aa  GUAA_PSEPG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      2e-05  31%  525 aa  GUAA_PSEP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      2e-05  32%  525 aa  GUAA_PSEMY RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::190     2e-05  32%  541 aa  GUAA_PHANO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::175     2e-05  28%  521 aa  GUAA_NEIG2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::109     2e-05  30%  525 aa  GUAA_HAMD5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      2e-05  29%  523 aa  GUAA_HAES2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   38::137     2e-05  28%  551 aa  GUAA_GLOVI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOUT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOSM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOSE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOLU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOLI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOLC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOL6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOL5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOK1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOHS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECODH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECOBW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECO8A RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECO81 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECO7I RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECO5E RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECO57 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECO55 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECO45 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-05  29%  525 aa  GUAA_ECO24 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   38::103     2e-05  40%  525 aa  GUAA_CHRVO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::149     2e-05  33%  516 aa  GUAA_CHLTE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      2e-05  30%  520 aa  GUAA_BRUSU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      2e-05  30%  520 aa  GUAA_BRUSI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      2e-05  30%  520 aa  GUAA_BRUO2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      2e-05  30%  507 aa  GUAA_BRUME RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      2e-05  30%  520 aa  GUAA_BRUMB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      2e-05  30%  520 aa  GUAA_BRUC2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      2e-05  30%  520 aa  GUAA_BRUAB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      2e-05  30%  520 aa  GUAA_BRUA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    7::97      2e-05  30%  520 aa  GUAA_BRUA1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   41::136     2e-05  31%  551 aa  GUAA_BRAJA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::98      2e-05  32%  518 aa  GUAA_BARBK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::198     2e-05  25%  529 aa  GUAA_ANAMM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::198     2e-05  25%  529 aa  GUAA_ANAMF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   69::185     2e-05  33%  190 aa  GUAAA_METS3 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   23::89      2e-05  37%  187 aa  GUAAA_METKA RecName: Full=GMP synthase [glutamine-hydrolyzing]
   61::200     3e-05  30%  759 aa  TRPG_SCHPO RecName: Full=Anthranilate synthase component 2;        
  361::543     3e-05  32%  543 aa  PYRG_PSESM RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  361::543     3e-05  32%  543 aa  PYRG_PSE14 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  321::443     3e-05  30%  540 aa  PYRG_LACJO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::97      3e-05  28%  525 aa  GUAA_SHIFL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      3e-05  28%  525 aa  GUAA_SHIF8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::186     3e-05  29%  526 aa  GUAA_PSYIN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::104     3e-05  33%  525 aa  GUAA_MYCTU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::104     3e-05  33%  525 aa  GUAA_MYCTA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::104     3e-05  33%  525 aa  GUAA_MYCBT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::104     3e-05  33%  525 aa  GUAA_MYCBP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::104     3e-05  33%  525 aa  GUAA_MYCBO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::196     3e-05  29%  520 aa  GUAA_GEOSL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      3e-05  28%  525 aa  GUAA_CITK8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::80      3e-05  45%  189 aa  GUAAA_HALMA RecName: Full=GMP synthase [glutamine-hydrolyzing]
  342::533     3e-05  34%  537 aa  PYRG_RICFE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  361::543     3e-05  33%  543 aa  PYRG_PSEFS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::110     3e-05  27%  525 aa  GUAA_SODGM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     3e-05  31%  539 aa  GUAA_RALEH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      3e-05  31%  525 aa  GUAA_PSEE4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::189     3e-05  27%  528 aa  GUAA_PROMM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      3e-05  29%  525 aa  GUAA_PROMH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      3e-05  32%  519 aa  GUAA_NITEC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      3e-05  29%  523 aa  GUAA_MANSM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::107     3e-05  28%  513 aa  GUAA_HELMI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      3e-05  29%  523 aa  GUAA_HAES1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     3e-05  30%  520 aa  GUAA_GEOSF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::196     3e-05  30%  525 aa  GUAA_CANGA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      3e-05  28%  523 aa  GUAA_ACTSZ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   19::80      3e-05  44%  184 aa  GUAAA_NATPD RecName: Full=GMP synthase [glutamine-hydrolyzing]
  441::541     4e-05  34%  545 aa  PYRG_TOLAT RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  333::419     4e-05  33%  536 aa  PYRG_ENTFA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    5::188     4e-05  29%  535 aa  GUAA_POLSQ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::188     4e-05  29%  535 aa  GUAA_POLNS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::184     4e-05  31%  524 aa  GUAA_NITOC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      4e-05  29%  523 aa  GUAA_HAEPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::196     4e-05  30%  520 aa  GUAA_GEOMG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::176     4e-05  25%  516 aa  GUAA_FRATO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::176     4e-05  25%  516 aa  GUAA_FRATN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::176     4e-05  25%  516 aa  GUAA_FRATH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::176     4e-05  25%  516 aa  GUAA_FRATF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     4e-05  30%  539 aa  GUAA_BURCJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      4e-05  29%  523 aa  GUAA_ACTPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      4e-05  29%  523 aa  GUAA_ACTP7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      4e-05  29%  523 aa  GUAA_ACTP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  361::543     6e-05  32%  543 aa  PYRG_PSEU2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  347::534     6e-05  34%  535 aa  PYRG_OCEIH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   10::198     6e-05  27%  525 aa  GUAA_TERTT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     6e-05  27%  525 aa  GUAA_SHELP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::103     6e-05  31%  525 aa  GUAA_RHORT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::109     6e-05  28%  525 aa  GUAA_PSEU2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      6e-05  30%  525 aa  GUAA_PSEPW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     6e-05  30%  520 aa  GUAA_PELCD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      6e-05  32%  519 aa  GUAA_NITEU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::184     6e-05  28%  524 aa  GUAA_METCA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::200     6e-05  29%  533 aa  GUAA_GLUOX RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   21::186     6e-05  33%  534 aa  GUAA_FRASN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::100     6e-05  39%  512 aa  GUAA_AERPE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   58::200     7e-05  24%  788 aa  TRPG_PHACH RecName: Full=Anthranilate synthase component 2;        
   12::198     7e-05  31%  543 aa  GUAA_USTMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     7e-05  27%  525 aa  GUAA_SHEPW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     7e-05  26%  525 aa  GUAA_SHEDO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::88      7e-05  32%  521 aa  GUAA_NEIG1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::105     7e-05  34%  526 aa  GUAA_METFK RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     7e-05  32%  525 aa  GUAA_EDWI9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::103     7e-05  34%  513 aa  GUAA_CHLPD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::198     7e-05  25%  525 aa  GUAA_CELJU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::106     7e-05  33%  521 aa  GUAA_AZOSB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   37::183     1e-04  29%  201 aa  TRPG_VIBCH RecName: Full=Anthranilate synthase component II;       
  330::399     1e-04  41%  537 aa  PYRG_LACPL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  361::542     1e-04  34%  543 aa  PYRG_AZOVD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  477::621     1e-04  31%  637 aa  PHZE_PSEFL RecName: Full=Anthranilate synthase, phenazine specific;
    8::107     1e-04  30%  513 aa  GUAA_SYMTH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     1e-04  26%  525 aa  GUAA_SHEPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     1e-04  26%  525 aa  GUAA_SHEHH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     1e-04  31%  539 aa  GUAA_RALPJ RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::103     1e-04  32%  513 aa  GUAA_PELLD RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::99      1e-04  28%  523 aa  GUAA_HAEDU RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::176     1e-04  25%  516 aa  GUAA_FRATM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::185     1e-04  29%  544 aa  GUAA_DECAR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     1e-04  31%  539 aa  GUAA_CUPTR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      1e-04  31%  527 aa  GUAA_BURXL RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      1e-04  31%  527 aa  GUAA_BURPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    8::168     1e-04  30%  188 aa  GUAAA_SULSO RecName: Full=GMP synthase [glutamine-hydrolyzing]
  320::388     1e-04  37%  539 aa  PYRG_CHLTR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  320::388     1e-04  37%  539 aa  PYRG_CHLTB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  320::388     1e-04  37%  539 aa  PYRG_CHLTA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  320::388     1e-04  37%  539 aa  PYRG_CHLT2 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::101     1e-04  32%  525 aa  GUAA_SHEWM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   35::129     1e-04  32%  507 aa  GUAA_PETMO RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::116     1e-04  34%  525 aa  GUAA_MYCPA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    4::174     1e-04  34%  511 aa  GUAA_CHLCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     1e-04  30%  539 aa  GUAA_BURM1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     1e-04  30%  539 aa  GUAA_BURCM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     1e-04  30%  539 aa  GUAA_BURA4 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   54::178     2e-04  29%  198 aa  TRPG_HALSA RecName: Full=Anthranilate synthase component II;       
   16::173     2e-04  25%  196 aa  TRPG_BUCAP RecName: Full=Anthranilate synthase component 2;        
  440::541     2e-04  30%  543 aa  PYRG_THICR RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  330::443     2e-04  31%  539 aa  PYRG_LACAC RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   21::97      2e-04  29%  534 aa  GUAA_SYNP6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     2e-04  26%  525 aa  GUAA_SHEFN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   14::109     2e-04  31%  536 aa  GUAA_PSYA2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::109     2e-04  27%  525 aa  GUAA_PSESM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::109     2e-04  27%  525 aa  GUAA_PSE14 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   40::88      2e-04  41%  521 aa  GUAA_NEIMB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::179     2e-04  26%  524 aa  GUAA_KLULA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-04  27%  525 aa  GUAA_ENTS8 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    6::106     2e-04  31%  521 aa  GUAA_AZOSE RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   49::167     2e-04  27%  188 aa  GUAAA_META3 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   62::188     2e-04  27%  188 aa  GUAAA_IGNH4 RecName: Full=GMP synthase [glutamine-hydrolyzing]
   79::173     2e-04  34%  194 aa  TRPG_HELPY RecName: Full=Anthranilate synthase component II;       
  326::417     2e-04  35%  530 aa  PYRG_LACSS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   14::90      2e-04  40%  528 aa  GUAA_SYNS3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      2e-04  28%  525 aa  GUAA_PSEFS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      2e-04  28%  525 aa  GUAA_PSEF5 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-04  40%  525 aa  GUAA_PECCP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   40::88      2e-04  39%  521 aa  GUAA_NEIMF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   40::88      2e-04  39%  521 aa  GUAA_NEIMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   40::105     2e-04  37%  521 aa  GUAA_NEIM0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     2e-04  30%  525 aa  GUAA_MARAV RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::97      2e-04  40%  525 aa  GUAA_ERWCT RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::102     2e-04  30%  547 aa  GUAA_BURPS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::102     2e-04  30%  547 aa  GUAA_BURP1 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   79::173     3e-04  33%  194 aa  TRPG_HELPJ RecName: Full=Anthranilate synthase component II;       
  339::409     3e-04  35%  535 aa  PYRG_STAHJ RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  320::389     3e-04  36%  535 aa  PYRG_LACBA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  342::402     3e-04  34%  535 aa  PYRG_BACLD RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  330::621     3e-04  25%  637 aa  PHZB_PSECL RecName: Full=Anthranilate synthase, phenazine specific;
   14::180     3e-04  30%  525 aa  GUAA_YEAST RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      3e-04  30%  539 aa  GUAA_BURP6 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      3e-04  30%  539 aa  GUAA_BURP0 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      3e-04  30%  539 aa  GUAA_BURMS RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      3e-04  30%  539 aa  GUAA_BURMA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      3e-04  30%  539 aa  GUAA_BURM9 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::94      3e-04  30%  539 aa  GUAA_BURM7 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     3e-04  29%  539 aa  GUAA_BURCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     3e-04  29%  539 aa  GUAA_BURCC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    5::130     3e-04  29%  539 aa  GUAA_BURCA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  462::539     4e-04  30%  543 aa  PYRG_PSEU5 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  453::532     4e-04  33%  543 aa  PYRG_PSEMY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::101     4e-04  25%  525 aa  GUAA_SHESR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     4e-04  25%  525 aa  GUAA_SHESM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     4e-04  25%  525 aa  GUAA_SHESA RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     4e-04  25%  525 aa  GUAA_SHEON RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::99      4e-04  27%  525 aa  GUAA_PSEPF RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::183     4e-04  23%  523 aa  GUAA_HAEIG RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::97      4e-04  29%  516 aa  GUAA_FRAP2 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   13::187     4e-04  30%  533 aa  GUAA_EMENI RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   37::197     4e-04  27%  429 aa  GUAA_CHLPN RecName: Full=Putative GMP synthase
   64::184     4e-04  31%  188 aa  GUAAA_SULTO RecName: Full=GMP synthase [glutamine-hydrolyzing]
  463::541     5e-04  32%  545 aa  PYRG_PHOLL RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   25::211     5e-04  28%  535 aa  GUAA_RHOPB RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::110     5e-04  34%  525 aa  GUAA_COLP3 RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   17::107     5e-04  38%  184 aa  GUAAA_METB6 RecName: Full=GMP synthase [glutamine-hydrolyzing]
  104::200     6e-04  32%  248 aa  YA14_SCHPO RecName: Full=Putative glutamine amidotransferase-like
   53::179     6e-04  22%  752 aa  TRPG_CRYNE RecName: Full=Anthranilate synthase component 2;        
  454::541     6e-04  29%  545 aa  PYRG_ERWT9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
   12::95      6e-04  35%  232 aa  HIS5_HALMA RecName: Full=Imidazole glycerol phosphate synthase
    5::180     6e-04  27%  534 aa  GUAA_METPP RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::106     6e-04  33%  520 aa  GUAA_CAUCR RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::106     6e-04  33%  520 aa  GUAA_CAUCN RecName: Full=GMP synthase [glutamine-hydrolyzing];     
  107::200     8e-04  29%  251 aa  YL126_YEAST RecName: Full=Putative glutamine amidotransferase
   53::179     8e-04  22%  752 aa  TRPG_CRYNV RecName: Full=Anthranilate synthase component 2;        
  454::541     8e-04  30%  545 aa  PYRG_YERPY RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  454::541     8e-04  30%  545 aa  PYRG_YERPS RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  454::541     8e-04  30%  545 aa  PYRG_YERPP RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  454::541     8e-04  30%  545 aa  PYRG_YERPN RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  454::541     8e-04  30%  545 aa  PYRG_YERPG RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  454::541     8e-04  30%  545 aa  PYRG_YERPE RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  454::541     8e-04  30%  545 aa  PYRG_YERPB RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  454::541     8e-04  30%  545 aa  PYRG_YERPA RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  454::541     8e-04  30%  545 aa  PYRG_YERP3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  329::402     8e-04  37%  534 aa  PYRG_STRA3 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  329::402     8e-04  37%  534 aa  PYRG_STRA1 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  347::441     8e-04  33%  532 aa  PYRG_LISMO RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  463::541     8e-04  31%  545 aa  PYRG_EDWI9 RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
  441::541     8e-04  33%  545 aa  PYRG_AERHH RecName: Full=CTP synthase;         EC=6.3.4.2;AltName:
    9::101     8e-04  25%  525 aa  GUAA_SHESW RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     8e-04  25%  525 aa  GUAA_SHEPC RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    9::101     8e-04  25%  525 aa  GUAA_SHEAM RecName: Full=GMP synthase [glutamine-hydrolyzing];     
   10::111     8e-04  25%  526 aa  GUAA_BAUCH RecName: Full=GMP synthase [glutamine-hydrolyzing];     
    1::382

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
CARA_ECOLI      MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
CARA_ECO57      MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
CARA_ECOL6      MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
CARA_SALTY      MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNKADE
CARA_SALTI      MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNEADE
CARA_YERPS      MIKSALLVLEDGTQFHGRAIGAEGTAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNASDE
CARA_YERPE      MIKSALLVLEDGTQFHGRAIGAEGTAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNASDE
CARA_ERWCT      MIKSALLVLEDGTQFHGRAIGAEGLAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGANANDE
CARA_PHOLL      MIKSAILVLEDGTQFHGRAIXXXXXXXXXXXFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGVNSVDK
CARA_VIBCH      MSKSALLVLEDGTVFRGVSIGADGISVGEVVFNTSMTGYQEILTDPSYSQQIVTLTYPHIGNTGTNSEDE
CARA_VIBPA      MSKLALLVLEDGTVFRGVSIGADGVSVGEVVFNTSMTGYQEILTDPSYSQQIVTLTYPHIGNTGTNSEDE
CARA_PHOPR      MSKSALLVLEDGTVFRXXXXXXXXXXXXEVVFNTSMTGYQEILTDPSYSQQIVTLTYPHIGNTGTNSEDE
CARA_VIBVU      MSKSALLVLEDGTVFRGVSIGADGISVGEVVFNTSMTGYQEILTDPSYSQQIVTLTYPHIGNXXXXXXXX
CARA_VIBVY      MSKSALLVLEDGTVFRGVSIGADGISVGEVVFNTSMTGYQEILTDPSYSQQIVTLTYPHIGNXXXXXXXX
CARA_SHEON      LTKSALLVLEDGTVFTGTAIGADGLSVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNTGTNNEDV
CARA_THISH      ----ALLALEDGSLFHGISIGAPGQTVGEVVFNTAMTGYQEILTDPSYARQIVTLTYPHIGNTGVNPEDE
CARA_PSEPK      MTKPAILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHIGNTGTTPEDA
CARA_PSEAE      MTKPAILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHIGNTGTTPEDA
CARA_TERTT      ----AILVLEDGSVFRGVSIGATGKSVGEVVFNTSITGYQEILTDPSYARQIVTLTYPHIGNTGTNSEDE
CARA_ACIAD      MSTPAILALADGTIFKXXXXXXXXXXXXEVVFNTAMTGYQEILTDPSYAQQLVTLTYPHIGNTGCNEEDT
CARA_PSEST      ----AILALADGSIFRGESIGADGQTIGEVVFNTAMTGYQEILTDPSYAKQIVTLTYPHVGNTGTTPQDA
CARA_HALER      MSKPAILALEDGSVFHGTAIGADGQTSGEVVFNTAMTGYQEILTDPSYSRQIVTLTYPHIGNTGVNSEDV
CARA_BUCAI      ----AVLVLEDGTKFHGRAIGAKGITVGEVVFNTSITGYQEIITDPSYSHQIVTLTHPHIGNVGTNSNDE
CARA_BUCAP      ----AVLVLEDGTRFHGRSIGAKGTTVGEVVFNTSITGYQEIITDPSYSHQIVTLTHPHIGNIGTNCNDE
CARA_PSESM      MTKPAILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHIGNTGTTPEDA
CARA_RALSO      ----AILALADGTVFRGYSIGAAGHTIGEVVFNTAITGYQEILTDPSYSRQIVTLTYPHIGNVGVNREDV
CARA_NEIMB      MSTPALLVLADGSVFHGTSIGYEGSTSGEVVFNTSMTGYQEILTDPSYCKQIVTLTYPHIGNTGTNAEDE
CARA_NEIMA      MSTPALLVLADGSVFHGTSIGYEGSTSGEVVFNTSMTGYQEILTDPSYCKQIVTLTYPHIGNTGTNAEDE
CARA_HAEDU      MFNPAILVLADGSTFYGKSIGVSAYSIGEVVFNTAMTGYQEILTDPSYAKQIVTLTYPHIGNTGTNDEDN
CARA_POLSQ      ----AVLALADGSIFHGFSIGAPGETTGEVVFNTALTGYQEIITDPSYCSQIVTLTYPHIGNVGVNAQDA
CARA_NEIGO      ----ALLVLADGSVFHGTSIGYEGSASGEVVFNTSMTGYQEILTDPSYCKQIVTLTYPHIGNTGTNAEDE
CARA_PASMU      MSEPAILVLADGSVFHGTSIGAKGHTVGEVVFNTAMTGYQEILTDPSYFRQIVTLTYPHIGNTGTNLEDC
CARA_XYLFA      MTEPAILVLEDGTVFEGDAVGANGLSVGEVVFNTSLTGYQEVLTDPSYAYQLVTLTYPHIGNTGCTDQDD
CARA_POLNS      ----AVLALADGSIFPGYSIGAPGETTGEVVFNTALTGYQEIITDPSYSRQIVTLTYPHIGNVGVNAQDA
CARA_XYLFT      MTEHAILVLEDGTVFEGDAVGANGLSVGEVVFNTALTGYQEILTDPSYAYQLVTLTYPHIGNTGCTDQDD
CARA_XANCP      MTQPAILVLEDGTVFEGESVGANGLSVGEVVFNTAMTGYQEVLTDPSYARQMVTLTYPHIGNTGFNDQDD
CARA_RHOGE      ----------DGTTFLGTSIGAPGRTVGEVVFNTALTGYQEILTDPSYCRQIVTLTYPHIGNVGVNEEDV
CARA_XANAC      MTQPAILVLEDGTVFEGESVGANGLSVGEVVFNTAMTGYQEVLTDPSYARQMVTLTYPHIGNTGFTDQDD
CARA_BUCBP      ---SATLVLKDGTIFYGKSVGIQGETYGEIVFNTSMTGYQEILTDPSYSNQIITFTYPHIGNVGINKNDC
CARA_OCHA4      --RTAILVLADGTVIEGKGLGAIGAIEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGTNAEDV
CARA_BRUSU      --RTAVLVLADGTVIEGKGLGATGAVEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGANAEDI
CARA_BRUSI      --RTAVLVLADGTVIEGKGLGATGAVEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGANAEDI
CARA_BRUC2      --RTAVLVLADGTVIEGKGLGATGAVEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGANAEDI
CARA_BRUO2      --RTAVLVLADGTVIEGKGLGATGAVEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGANAEDI
CARA_BRUME      --RTAVLVLADGTVIEGKGLGATGAVEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGANAEDI
CARA_BRUMB      --RTAVLVLADGTVIEGKGLGATGAVEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGANAEDI
CARA_BRUAB      --RTAVLVLADGTVIEGKGLGATGAVEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGANAEDI
CARA_BRUA2      --RTAVLVLADGTVIEGKGLGATGAVEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGANAEDI
CARA_BRUA1      --RTAVLVLADGTVIEGKGLGATGAVEAEVVFNTALTGYEEILTDPSYAGQIVTFTFPHIGNVGANAEDI
CARA_RHILO      ---TALLVLADGTVIEGRGLGATGSAVAEVCFNTALTGYQEILTDPSYAGQIVTFTFPHIGNIGTNGEDI
CARA_BRAJA      ---TALLVLADGTVLEGFGLGAEGHAVGEVCFNTAMTGYEEILTDPSYAGQLITFTFPHIGNVGTNEEDI
CARA_ZYMMO      ------MVLADGQMIWGRGFGATGAKVGEVCFHTAMTGYEEIMTDPSFASQIINFTFPHIGNVGANREDV
CARA_BARQU      ---TALLILADGTVIEGKGAGATGVAEGEICFNTAMTGYEEILTDPSYKKQIINFTFPHIGNVGTNSEDI
CARA_RHIME      ---TALLVLADGTVIEGKGIGATGTVQAEVCFNTALTGYQEILTDPSYLGQIVTFTFPHIGNIGANDEDI
CARA_BARHE      ---TALLVLANGTVIEGKGAGATGFAEAEICFNTAMTGYEEILTDPSYKKQIVNFTFPHIGNVGTNSEDI
CARA_AGRT5      ---TAMLVLADGTVIEGTGIGATGKVQAEVCFNTALTGYEEILTDPSYLGQIVTFTFPHIGNVGTNEEDI
CARA_PROA2      ----AKLVLENGSVYTGYAFGHIGETGGEVVFNTALTGYQEIVTDPSYAGQMVVMTYPLIGNYGVNQSDA
CARA_CHLTE      ----AILVLENGSVYRGTAFGHAGEATGEVVFNTSLTGYQEILTDPSYTGQMVVMTYPLIGNYGITPNDN
CARA_BART1      ---TALLVLADGTVIEGKGAGATGIAEAELCFNTAITGYEEILTDPSYTQQIVNFTFPHIGNVGANSEDI
CARA_SYNY3      --KPALLVLADGTPYPGWSFGADGTTVGEVVFNTGMTGYQEVMTDPSYCGQIVTFTYPELGNTGVNAEDE
CARA_RHOBA      --KAAKLALEDGTVYTGTSLGAEGETTGEVVFNTSMTGYQEILTDPSYRGQLVTMTYPEMGNYGINSIDL
CARA_PELCD      ----AILALADGRVFTGKAFGARGEVTGEVVFNTSMTGYQEILTDPSYCGEIVTMTYPLIGNYGINPEDV
CARA_BARBK      ---TALLVLADGTXXXXXXXXXXXXXXXXXCFNTAITGYEEILTDPSYTGQIINFTFPHIGNVGTNSEDE
CARA_WIGBR      LLNKALLILEDGTKFYGNSIGAKGTSIGEVIFNTSITGYQEIITDPSYFNQIVAFTYPHXXXXXXXXXXX
CARA_ANASP      ----ALLVLADGTAYRGWSFGATGTTIGEVVFNTGMTGYQEVLTDPSYRGQIVVFTYPELGNTGVNPEDE
CARA_SYNE7      --QAALLVLADGSVFHGYACGAAGTVIGEVVFNTGMTGYQEVLTDPSYCGQIVSFTYPELGNTGVNPEDE
CARA_THEEB      ----ALLVLADGSVFRGFSFGAPGTAIGEVVFNTGMTGYQEVLTDPSYYGQIVTFTYPELGNTGTTPEDD
CARA_SYNP6      --QAALLVLADGSVFHGYACGAAGTVIGEVVFNTGMTGYQEVLTDPSYCGQIVSFTYPELGNTGVNPEDE
CARA_SILPO      ---TACLVLADGTVFYGTGFGATGQTVAELCFNTAMTGYQEIMTDPSYAGQIVTFTFPHIGNVGVTPEDD
CARA_AQUAE      MRKTAILALEDGSYFVGYSFGAEGETGGELVFNTSMTGYQEILTDPSYKGQIVVMTYTQIGNYGVNDEDI
CARA_PORPU      MIKKAILVLEDGTYYKGWSFQADQSIVGEVVFNTGMTGYQEIITDPSYFQQIVTFTYPEIGNTGINSEDI
CARA_LEPIN      ----AFLVLDNGTIFEGESFGYETESVGEIVFNTSMAGYQEILTDPSYCNQIITLTYPMIGNYGIHPDNM
CARA_LEPIC      ----AFLVLDNGTIFEGESFGYETESVGEIVFNTSMAGYQEILTDPSYCNQIITLTYPMIGNYGIHPDNM
CARA_SYNPX      --RQAHLVLADGTVLTGDAFGHRGSVVGEVVFNTGMTGYQEVLTDPSYAGQLVTFTYPELGNTGVNGDDQ
CARA_MARMM      ------LALADGSVFLGHGTGATGIALGEVCFNTAMTGHQEILADPSYAGQVVCFTFPHVGNVGANGEDE
CARA_AKKM8      ----AILALEDGSVFIGSHFGATGTEVGEACFNTSMTGYQEVLTDPSYSGQIVTMTYPLIGNYGVNPEDG
CARA_LEPBL      ----AFLVLDNGMILEGESFGYESESVGEIVFNTSMAGYQEILTDPSYCNQIITLTYPMIGNYGIHPDNM
CARA_LEPBJ      ----AFLVLDNGMILEGESFGYESESVGEIVFNTSMAGYQEILTDPSYCNQIITLTYPMIGNYGIHPDNM
CARA_CAUCR      ---TGVLALADGAILQXXXXXXXXXXXXXXXFNTAMTGYQEILTDPSYMAQIVAFTFPHXXXXXXXXEDV
CARA_STRCO      ----AVLVLEDGRIFRGRAYGAVGATFGEAVFSTGMTGYQETLTDPSYHRQVVVMTAPHVGNTGINDEDM
CARA_DEIRA      ----AILALEDGTVYRGYAFGYRGETVGEVVFNTSMTGYQEIMTDPSYNGQIVTITYPHVGNYGVAIYDM
CARA_DEIGD      ----AILALEDGTVYRGYAFGHRGETVGEVVFNTSMTGYQEIMTDPSYNGQIVTITYPHVGNYGVAIYDM
CARA_BACCL      ------LILEDGSFFVGERFGSLKETTGEVVFNTGMTGYQEILSDPSYCGQIVTMTYPLIGNYGINRDDF
CARA_DESAD      ----AILALEDGTYFEGTSFTGPGESGGEAIFNTGMTGYQEVLTDPSYTGQMVCMTYPLIGNYGITKEDI
CARA_THEMA      MSKKALLALEDGSFFFGQSLGAEGETFGELVFNTGMTGYQEVLTDPSYTGQIVVMTYPEIGIYGVNDEDV
CARA_STRAW      ----AVLVLEDGRTFRGRAYGAVGVTFGEAVFSTGMTGYQETLTDPSYHRQVVVMTAPHVGNTGVNDEDP
CARA_OCEIH      -MKKRKLILEDGTVFNGTAFGSDAESSGEIVFNTGMTGYQEVITDPSYCGQFVTLTYPLIGNYGINRDDF
CARA_SYNR3      -----LLVLADGTVFRGQGFGAKGTAIGEVVFNTGMSGYQEVITDPSYTGQLITFTYPELGNTGVNQEDL
CARA_HYPNA      ------LALEDGTIXXXXXXXXXXIKVGELCFNTAITGYQEILTDPSYASQLVLFTFPHIGNVGANAEDH
CARA_HELHP      ILKEAYLYFANGLFFKAQSFGSDGTFVGEVVFNTSMSGYQEVITDPSYSGQFIVFSMPEIGIVGVNNQDS
CARA_STRR6      -----ILVLEDGTVFEGKAFGADIDVTGEIVFNTGMTGYQESITDQSYNGQILTFTYPLVGNYGINRDDY
CARA_STRPN      -----ILVLEDGTVFEGKAFGADIDVTGEIVFNTGMTGYQESITDQSYNGQILTFTYPLVGNYGINRDDY
CARA_LISMO      -----ILMLEDGNYFIGDAIGSEKETIGEVVFNTGMTGYQETITDPSYYGQIITFTYPLVGNYGVNRDDF
CARA_CORDI      ----AVLVLADGRIFKGESFGAEGATLGEAVFTTAMSGYQETMTDPSYHRQIVVATAPQIGNTGWNDEDG
CARA_BACHD      ------LILEDGSVFVGKGFGSDREMSGEVVFNTGMTGYQEMLSDPSYCGQIVTLTYPLIGNYGINRDDF
CARA_ARCFU      ----AALALEDGTYLEGKAFGAERGGLGEIVFCTSMTGYVEALTDPSYKGQILMMTYPLIGNYGVNREDF
CARA_STRP6      -----LLILEDGTIFEGEPFGADIDVTGEIVFNTGMTGYQESITDQSYNGQILTFTYPLIGNYGINRDDY
CARA_STRP3      -----LLILEDGTIFEGEPFGADIDVTGEIVFNTGMTGYQESITDQSYNGQILTFTYPLIGNYGINRDDY
CARA_STRP1      -----LLILEDGTIFEGEPFGADIDVTGEIVFNTGMTGYQESITDQSYNGQILTFTYPLIGNYGINRDDY
CARA_STAEQ      MLEKRYLVLEDGSYYEGYRLGSDDLSIGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_PORYE      ----AILVLEDGAYYKGWSFQQDKQTIGEVVFNTGMTGYQEIITDPSYFHQIVAFTYPEIGNTGINNQDI
CARA_STRP8      -----LLILEDGTIFEGEPFGADIDVTGEIVFNTGMTGYQESITDQSYNGQILTFTYPLIGNYGINRDDY
CARA_STAS1      MLKKRYLVLEDGSYYEGYPIGSDQLTLGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_STAHJ      MLERRYLVLEDGTYYEGYKLGSNDLSVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_GRATL      ----AILVLKDGKFYRGWTLINSIISFGEVVFNTGMTGYQEIMTDPSYAEQIITFTYPEIGNTGINHEDN
CARA_BACSU      ------LVLENGAVFEGEAFGSLEHNMGEVVFNTGMTGYQEILSDPSYCGQIVTLTYPLIGNYGINRDDF
CARA_STAES      MLEKRYLVLEDGSYYEGYRLGSDDLSIGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_LISMF      -----ILMLEDGNYFIGDAIGSEKETIGEVVFNTGMTGYQETITDPSYYGQIITFTYPLVGNYGVNRDDF
CARA_FUSNN      ------LILEDGTVYKGYAFGADVENVGEVVFNTSMTGYQEILSDPSYNGQIVTLTYPLIGNYGINRDDF
CARA_BACCR      ------LILEDGTVLIGTGFGGEIEKSGEVVFTTGMTGYQETLSDPSYCGQIVTFTYPLIGNYGINRDDF
CARA_LISIN      -----ILMLEDGNYFIGDAIGSEKETIGEVVFNTGMTGYQETITDPSYYGQIITFTYPLVGNYGVNRDDF
CARA_SYMTH      --------MEDGTLFAGAGFGAPAVQAGEVVFNTGMTGYQEVVTDPSYYGQIVVMTYPLIGNYGVTAADG
CARA_STRMU      -----LLILEDGTIFEGQAFGADLDVTGEIVFNTGMTGYQESITDQSYNGQILTFTYPLVGNYGINRDDY
CARA_STRA5      -----LLLLEDGSVFEGEAFGADVETSGEIVFSTGMTGYQESITDQSYNGQIITFTYPLIGNYGINRDDY
CARA_STRA3      -----LLLLEDGSVFEGEAFGADVETSGEIVFSTGMTGYQESITDQSYNGQIITFTYPLIGNYGINRDDY
CARA_CLOPE      ----AKLILENGVVFEGKAFGYLKECVGEVVFNTGMTGYQEVLTDPSYYGQIVTMTYPLIGNYGINLEDL
CARA_THET8      ----AVLVLEDGTVYHGYAFGARGKTVGEVVFNTAQTGYQEIMTDPSYHGQIVVMTYPHQGNYGVNVYDM
CARA_THET2      ----AVLVLEDGTVYHGYAFGARGKTVGEVVFNTAQTGYQEIMTDPSYHGQIVVMTYPHQGNYGVNVYDM
CARA_STAAW      ------LVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_STAAS      ------LVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_STAAR      ------LVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_STAAN      ------LVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_STAAM      ------LVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_STAAC      ------LVLEDGSFYEGYRLGSDNLTVGEIVFNTAMTGYQETISDPSYTGQIITFTYPLIGNYGINRDDF
CARA_BACHK      ------LILEDGTVLIGTGFGGEIEKSGEVVFTTGMTGYQETLSDPSYCGQIVTFTYPLIGNYGINRDDF
CARA_BACAN      ------LILEDGTVLIGTGFGGEIEKSGEVVFTTGMTGYQETLSDPSYCGQIVTFTYPLIGNYGINRDDF
CARA_METKA      ----AALALEDGTIVHGELFGSPREAEGEVVFNTSHTGFQEALTDPSYRGQILIMTFPMQGNYGILPEVG
CARA_CLOAB      -----IIYLEDGTVFYGTGFGKEGNEFGEIVFNTSMTGYQEILTDPSYAGQIINMTYPLIGNYGVNESVN
CARA_LACPL      ------LVLEDGTIYPXXXXXXXXXXXXELVFNTGMSGYQESITDQSYNGEILMFTYPLIGNYGINRDDH
CARA_BACC1      ------LILEDGTVLIGTGFGGEIEKSGEVVFTTGMTGYQETLSDPSYCGQIVTFTYPLIGNYGINRDDF
CARA_COREF      ----AYLVLADGRTFKGFGFGAIGTTLGEAVFTTAMTGYQETMTDPSYHRQIVVATAPQIGNTGWNEEDN
CARA_BIFLI      ----AVLVLEDGQVYVGEPYGALGETTGEIVFATGMTGYQETLTDPSYDRQIVVQTFPHIGDTGVNSEDP
CARA_BIFLO      ----AVLVLEDGQVYVGKPYGALGETTGEIVFATGMTGYQETLTDPSYDRQIVVQTFPHIGDTGVNSEDP
CARA_BACCZ      ------LILEDGTVLIGTGFGGEIEKSGEVVFTTGMTGYQETLSDPSYCGQIVTFTYPLIGNYGINRDDF
CARA_THETN      ------LKLEDGSIFEGELISKNKKGYGEVVFTTGMTGYQEAITDPSYAGQIVVMTYPLIGNYGINKYDF
CARA_MYCTU      -MSKAVLVLEDGRVFTGRPFGATGQALGEAVFSTGMSGYQETLTDPSYHRQIVVATAPQIGNTGWNGEDS
CARA_MYCBO      -MSKAVLVLEDGRVFTGRPFGATGQALGEAVFSTGMSGYQETLTDPSYHRQIVVATAPQIGNTGWNGEDS
CARA_BIFLD      ----AVLVLEDGQVYVGEPYGALGETTGEIVFATGMTGYQETLTDPSYDRQIVVQTFPHIGDTGVNSEDP
CARA_LACLM      -----LLILEDGTIFEGEALGANLDVTGELVFNTGMTGYQESITDQSYNGQILTFTYPIVGNYGVNRDDY
CARA_LACLA      -----LLILEDGTIFEGESLGANLDVTGELVFNTGMTGYQESITDQSYNGQILTFTYPIVGNYGVNRDDY
CARA_METM7      -----ILVLEDGTIIRGDGFGAEAEVLGELVFNTSMTGYVEILTDPSYKGQIITMTYPLEGNYGVEKEWF
CARA_METMP      -----ILVLEDGTIIRGEGFGAETEVLGELVFNTSMTGYVEILTDPSYKGQIITMTYPLEGNYGVEKEWF
CARA_DESMR      ----AILALEDGTLFHGHTFTGEGSAGGEVIFNTGMTGYQEVLTDPSYTGQMVCMTYPHVGNYGINPEDI
CARA_METM5      -----ILVLEDGTIIRGDGFGAETEVLGELVFNTSMTGYVEILTDPSYKGQIVTMTYPLEGNYGVEKEWF
CARA_DESVV      ----ALLALEDGFVLEGRSFTGPGETGGEAIFNTGMTGYQEVLTDPSYAGQMVCMTYPLVGNYGVTREDM
CARA_DESVH      ----ALLALEDGFVLEGRSFTGPGETGGEAIFNTGMTGYQEVLTDPSYAGQMVCMTYPLVGNYGVTREDM
CARA_METM6      -----ILVLEDGTIIRGDGFGAETEVLGELVFNTSMTGYVEILTDPSYKGQIVTMTYPLEGNYGVEKEWF
CARA_METJA      ----AVLILEDGTILKGKGFGAEKEVFGELVFTTVMTGYVEVLTDPSYKGQIVMMTYPLEGNYGVKKDWF
CARA_MYCPA      MSGKAQLVLEDGRVFTGTAFGAIGQTLGEAVFSTGMSGYQETLTDPSYHRQIVVATAPQIGNTGWNGEDA
CARA_CYACA      ---------EDGTVFRGKSFSNPQTVTGEIVFNTGMTGYQEIFTDPSYNEQLVVLTYPEIGNTGTNLDDY
CARA_METAC      ----AVLGLEDGTVIRGTGFGAEGTACGELVFTTQFTGYEEALTDPSYKGQILMFTYPLIGNYGVSGERF
CARA_METMA      ----AVLGLEDGTVIKGTGFGAEGTACGELVFTTQFTGYEEALTDPSYKGQILMFTYPLIGNYGVSGERF
CARA_DESDA      ----ALLVLEDGFTLEGKSFTGDFETGGEVIFTTGMTGYQEILTDPSYYGQMVCMTYPLIGNYGTCREDM
CARA_DESVM      ----AFLALEDGFVLEGRSFTGRGESGGEVIFNTGMTGYQEVLTDPSYAGQMVCMTYPLIGNYGVTAEDM
CARA_CORGL      ----AYLVLADXXXXXXXXXXXXXXXXXEAVFTTAMTGYQETMTDPSYHRQIVVATAPQIGNTGWNDEDN
CARA_MYCLE      -MSKALLVLEDGRVFTGMPFGAIGQTLGEAVFSTGMSGYQETLTDPSYHRQIVVATAPQIGNTGWNDQDG
CARA_METVS      -----ILVLEDGTIIRGKGFGAEAEVLGELVFNTSMTGYVEILTDPSYNGQIVTMTYPLEGNYGVDKRWF
CARA_HELAH      ------LYLENGLFLQVQSFGASGTQVGELVFNTSMSGYQEVISDPSYKGQFVIFSMPEIGVVGANSKDD
CARA_HELPJ      ------LYLENGLFLQAQSFGASGTQVGELVFNTSMSGYQEVISDPSYKGQFVVFSMPEIGVVGANPKDD
CARA_METTH      MFKEAKLALEDGTIIRGEAFGSETVKTGEVVFATGMTGYVESLTDPSYRGQILMPTYPLQGNYGVTEEWY
CARA_LAWIP      ----ALLALEDGFILEGQSINGHCESSGEVIFNTGMTGYQEILTDPSYYGQMVCMTWPLIGNYGINKEDM
CARA_CHAGB      ----ATLTIRDGPVFHGTAFGANSNISGEAVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGSNQRDE
CARA_HELPY      ------LYLENGLFLQAQSFGASGTQAGELVFNTSMSGYQEVISDPSYKGQFVVFSMPEIGVVGANSKDD
CARA_NEUCR      --------IRDGPVFQGTAFGANTNISGEAVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGSNERDE
CARA_CAMJE      ----AYIYLENDIFLSAKAFGKSGTFFGELVFNTSLTGYQEIISDPSYAGQFIVFSMPEIGIVGTNENDN
CARA_ASPNC      ----ATFTIRDGPIFHGKSFGARSNISGEAVFTTSLVGYPESLTDPSYRGQILVFTQPLIGNYGVPSAER
CARA_DEBHA      ----ATLTIKDGPVFSGYSFGANKNISGEAVFTTSLVGYPESMTDPSYKGQILCFTQPLIGNYGVPSSDE
CARA_ASPOR      ----ATFTIRDGPIFHGKSFGARSNISGEAVFTTSLVGYPESLTDPSYRGQILVFTQPLIGNYGVPSAEK
CARA_SCHPO      ----ATLTIRNGPIFHGTSFGANRNVSGEAVFTTSPVGYVESLTDPSYKQQILIFTQPLIGNYGVPDCKK
CARX_BACST      ----AYLHVASGKTFSGELAAPLEEKVGEIVFFTGMTGYQEVLTDPSYKNQIIVFTYPLIGNYGINENDF
CARA_KLULA      -------------EFQGYSFGAPVSCSGEAVFTTSLVGYPESMTDPSYKGQILVFTQPLIGNYGVPSGEE
CARA_CANAL      ----ATLTIKDGPVFNGYSFGANRNVSGEAVFTTSLVGYPESMTDPSYRGQILCFTQPLIGNYGVPSSTA
PYR1_HUMAN      ----AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIDEMDE
CARA_TRIVE      ----ATFTIRDGPVFRGKAFGANANISGEAVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGSNERDE
CARX_BACHD      ----AYLVLATGETFAGEIANAKEDVYGEVVFFTGMTGYQEVLSDPSFKGQLVVFTYPLIGNYGINASDF
CARA_YEAST      ----ATFCIQNGPSFEGISFGANKSVAGETVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGVPSGEA
CARA_YARLI      --------LQNGPVFTGRSFGANRVVSGEAVFSTGMVGYPESMTDPSYRGQILVFTQPLIGNYGVPSGKE
PYR1_SQUAC      ----ATLFLDDGSSFKGRLFGASSTVSGEVVFQTGMVGYPEALTDPSYLSQILVLTYPLIGNYGIPKDEE
PYR1_MESAU      ----AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGSDEEDE
CARX_BACSU      ------LVLEDGTSFSGELDGHE-NCTGEAVFFTGMTGYQEVLTDPSYKGQIIVFTYPLIGNYGINEKDF
PYR1_EMENI      ------LELEDGTVYQGYNFGAEKSVAGELVFQTGMVGYPESITDPSYRGQILVITFPLVGNYGVPSRET
PYR1_SCHPO      --KLMALELEDKSVLQGYSFGADHSVSGELVFQTGMVGYPESLTDPSYRGQILVFTFPTVGNYGVPDRDE
CARA_PYRAE      --------MEDGSVFAGRLIGAEKIAVGEVVFTTSVVGYPQTLTDPSYKGQIITFTMPLIGNYGVSEDQL
CARA_PHANO      -LENATFTIKNGPIFSGKSFGAKANISGEAVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGVPSSDE
CPSM_HUMAN      --QTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTDE
CARX_LACPL      ------LTLADGTQWIGTAIGDCQEAAGRIVFNTGMTGYQETLTDPSYLNQMIAFTYPLIGNYGIDPTVA
PYR1_DROME      ------LALEDGTVLPGYSFGYVPSENGEVVFQTGMVGYTEALTDRSYSGQILVLTYPLIGNYGVPAPDE
PYR1_DICDI      --KKGCLVLEDGTKLSGYSFGSERSVAGECVFSTGMVGYNESISDPSYTGQILVFSFPLIGNYGVPSFRE
CPSM_MOUSE      --KTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEALTDPAYKGQILTMANPIIGNGGAPDTDE
CARA_CANGA      -MSQATFEIKNGPSFSGYSFGADKSISGEAVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGVPSMEA
CPSM_RAT        --QTAHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYSEALTDPAYKGQILTMANPIIGNGGAPDTDE
CARA_NEOFI      ----ATFTIRDGPIFHGKSFGARTNISGEAVFTTSLVGYPESLTDPSYRGQILVFTQPLIGNYGVPSAER
CARA_ASPFU      ----ATFTIRDGPIFHGKSFGARTNISGEAVFTTSLVGYPESLTDPSYRGQILVFTQPLIGNYGVPSAER
PYR1_YEAST      ------LELKDGTVLQGYSFGAEKSVAGELVFQTGMVGYPESVTDPSYEGQILVITYPLVGNYGVPDMDE
CARA_COCIM      ----ATFTIRDGPVFHGKSFGAKKNISGEAVFTTSLVGYPESLSDPSYRGQILVFTQPLIGNYGVPSAEK
CARA_ASPCL      ----ATFTIRDGPIFHGKSFGARTNISGEAVFTTSLVGYPESLTDPSYRGQILVFTQPLIGNYGVPSAER
CPSM_RANCA      --QTANLVLEDGTKIKGYSFGHPASVAGEVIFNTGLGGYVEAVTDPSYHGQILTLTNPIIGNGGAPDTKA
CARA_ASHGO      --KKARFCLHGGPSYEGYSFGAPVSVGGEVVFTTSLVGYPDSMTDPSYKGQILVFTQPLIGNYGVPDGSV
CARA_HALSA      -MSDAYLALETGDVVEATA-RAPGMARGELVFTTAYTGYEESLTDPSYEAQVLTFAYPLIGNYGVRPERT
CARA_HALS3      -MSDAYLALETGDVVEATA-RAPGMARGELVFTTAYTGYEESLTDPSYEAQVLTFAYPLIGNYGVRPERT
CARA_SULSO      --KKGYLYLEDGTFIEGYSFGAKGIKVGEVVFTTSMNGYVESLTDPSYKGQILIITHPLVGNYGVPETNF
CARA_SULAC      --------LEDGTLMKGIGFGAKGIRVGEIVFTTSMNGYPESLTDPSYKGQILVITHPLIGNYGVPEKNY
CARA_METS5      -----LIYLEDGTLLRGCGFGAKGVRYGEVVFTTAMNGYPESMTDPSYRGQILIITHPLVGNYGVPNPNF
CARA_PYRFU      --KKGYLVLEDGSVIEGKAFGAETIRYGEVVFTTAMVGYPESLTDPSYKGQILIATNPLMGTYGVSSKSY
CARA_EMENI      -VERATFTIRDGPIFHGKSFGARTTISGEAVFTTSLVGYPESLTDPSYRGQILVFTQPLIGNYGVPSTER
CARA_SULTO      ------LYLEDGTLIEGCGFGAKGIRAGEVVFTTSMNGYPESLTDPSYRGQILVITHPLVGNYGVPEKQR
CARA_THEVO      ------LVMEDGTVLSGQGYGSYKEAYGELVFTTSMTGYLETLTDPSYVGQMLVFASPTIANYALEMGKM
CARA_THEAC      ------LITSDGTVIAGYGYGSPVTGYGELVFTTSMTGYLESMTDPSYVGQILVFASPTIANYELRKGVM
TRPG_THEMA      ----------------------------------------------------------------------
TRPG_PYRKO      ----------------------------------------------------------------------
TRPG_METJA      ----------------------------------------------------------------------
TRPE_RHIME      ----------------------------------------------------------------------
TRPG_AZOBR      ----------------------------------------------------------------------
TRPG2_HALMA     ----------------------------------------------------------------------
PABA_BACSU      ----------------------------------------------------------------------
GUAAA_METBF     ----------------------------------------------------------------------
TRPG_PORPU      ----------------------------------------------------------------------
GUAAA_UNCMA     ----------------------------------------------------------------------
GUAAA_METST     ----------------------------------------------------------------------
GUAAA_METBU     ----------------------------------------------------------------------
TRPG_PORYE      ----------------------------------------------------------------------
TRPG_LACLA      ----------------------------------------------------------------------
GUAA_FUSNN      ----------------------------------------------------------------------
PABA_KLEAE      ----------------------------------------------------------------------
TRPG_ACIAD      ----------------------------------------------------------------------
GUAA_BIFLO      ----------------------------------------------------------------------
PABS_STRGR      ----------------------------------------------------------------------
GUAA_ALKMQ      ----------------------------------------------------------------------
TRPG_SULSO      ----------------------------------------------------------------------
TRPG_CYAPA      ----------------------------------------------------------------------
GUAA_LACAC      ----------------------------------------------------------------------
TRPG_YEAST      ----------------------------------------------------------------------
GUAA_LACRJ      ----------------------------------------------------------------------
GUAA_LACRD      ----------------------------------------------------------------------
GUAA_LACGA      ----------------------------------------------------------------------
GUAA_CLOK5      ----------------------------------------------------------------------
GUAA_CLOK1      ----------------------------------------------------------------------
TRPG_PSEPU      ----------------------------------------------------------------------
PABA_SALTY      ----------------------------------------------------------------------
GUAA_RUTMC      ----------------------------------------------------------------------
GUAA_BACC2      ----------------------------------------------------------------------
GUAA_THICR      ----------------------------------------------------------------------
GUAA_LISMO      ----------------------------------------------------------------------
GUAAA_METAC     ----------------------------------------------------------------------
TRPG_LEPBI      ----------------------------------------------------------------------
GUAA_LISMF      ----------------------------------------------------------------------
GUAA_BACCN      ----------------------------------------------------------------------
GUAA_WOLWR      ----------------------------------------------------------------------
GUAA_WOLPM      ----------------------------------------------------------------------
GUAA_OCEIH      ----------------------------------------------------------------------
GUAA_CALS8      ----------------------------------------------------------------------
GUAA_BACSU      ----------------------------------------------------------------------
GUAA_BACCR      ----------------------------------------------------------------------
TRPG_PSEAE      ----------------------------------------------------------------------
TRPG_PENCH      ----------------------------------------------------------------------
PABA_SERMA      ----------------------------------------------------------------------
GUAA_STRZP      ----------------------------------------------------------------------
GUAA_CORAM      ----------------------------------------------------------------------
GUAA_BACLD      ----------------------------------------------------------------------
GUAA_BACC4      ----------------------------------------------------------------------
GUAA_STRMU      ----------------------------------------------------------------------
GUAA_LISIN      ----------------------------------------------------------------------
GUAAA_PYRAB     ----------------------------------------------------------------------
GUAA_ANATD      ----------------------------------------------------------------------
GUAA_SULNB      ----------------------------------------------------------------------
GUAA_LACJO      ----------------------------------------------------------------------
GUAA_CORGL      ----------------------------------------------------------------------
GUAA_CORGB      ----------------------------------------------------------------------
GUAA_CLONN      ----------------------------------------------------------------------
GUAA_CLOBA      ----------------------------------------------------------------------
GUAA_BACWK      ----------------------------------------------------------------------
GUAA_BACA2      ----------------------------------------------------------------------
GUAA_TROWT      ----------------------------------------------------------------------
GUAA_STRZT      ----------------------------------------------------------------------
GUAA_STRZJ      ----------------------------------------------------------------------
GUAA_STRR6      ----------------------------------------------------------------------
GUAA_STRPS      ----------------------------------------------------------------------
GUAA_STRPN      ----------------------------------------------------------------------
GUAA_STRPJ      ----------------------------------------------------------------------
GUAA_STRPI      ----------------------------------------------------------------------
GUAA_STRP7      ----------------------------------------------------------------------
GUAA_STRP4      ----------------------------------------------------------------------
GUAA_STRP2      ----------------------------------------------------------------------
GUAA_LEGPL      ----------------------------------------------------------------------
GUAA_LEGPA      ----------------------------------------------------------------------
GUAA_DEIGD      ----------------------------------------------------------------------
GUAA_BACC1      ----------------------------------------------------------------------
TRPG_HAEIN      ----------------------------------------------------------------------
GUAA_THEFY      ----------------------------------------------------------------------
GUAA_SULDN      ----------------------------------------------------------------------
GUAA_NITSB      ----------------------------------------------------------------------
GUAAA_PYRHO     ----------------------------------------------------------------------
GUAAA_METMA     ----------------------------------------------------------------------
GUAA_LEGPC      ----------------------------------------------------------------------
GUAA_LACDB      ----------------------------------------------------------------------
GUAA_LACDA      ----------------------------------------------------------------------
GUAA_JANMA      ----------------------------------------------------------------------
GUAA_XYLFT      ----------------------------------------------------------------------
GUAA_XYLFM      ----------------------------------------------------------------------
GUAA_XYLF2      ----------------------------------------------------------------------
GUAA_STRA5      ----------------------------------------------------------------------
GUAA_STRA3      ----------------------------------------------------------------------
GUAA_STRA1      ----------------------------------------------------------------------
GUAA_RHIEC      ----------------------------------------------------------------------
GUAA_ELUMP      ----------------------------------------------------------------------
GUAA_CLOBB      ----------------------------------------------------------------------
GUAA_BORGA      ----------------------------------------------------------------------
GUAA_BACHK      ----------------------------------------------------------------------
GUAA_BACCZ      ----------------------------------------------------------------------
GUAA_BACC3      ----------------------------------------------------------------------
GUAA_BACC0      ----------------------------------------------------------------------
GUAA_BACAN      ----------------------------------------------------------------------
GUAA_BACAH      ----------------------------------------------------------------------
GUAA_BACAC      ----------------------------------------------------------------------
GUAA_BACAA      ----------------------------------------------------------------------
GUAAA_PYRKO     ----------------------------------------------------------------------
PABA_ECOLI      ----------------------------------------------------------------------
GUAA_TROW8      ----------------------------------------------------------------------
GUAA_RHIE6      ----------------------------------------------------------------------
GUAA_CLOTE      ----------------------------------------------------------------------
TRPG_PHYBL      ----------------------------------------------------------------------
GUAA_STAAW      ----------------------------------------------------------------------
GUAA_STAAT      ----------------------------------------------------------------------
GUAA_STAAS      ----------------------------------------------------------------------
GUAA_STAAR      ----------------------------------------------------------------------
GUAA_STAAN      ----------------------------------------------------------------------
GUAA_STAAM      ----------------------------------------------------------------------
GUAA_STAAE      ----------------------------------------------------------------------
GUAA_STAAC      ----------------------------------------------------------------------
GUAA_STAA9      ----------------------------------------------------------------------
GUAA_STAA8      ----------------------------------------------------------------------
GUAA_STAA3      ----------------------------------------------------------------------
GUAA_STAA2      ----------------------------------------------------------------------
GUAA_STAA1      ----------------------------------------------------------------------
GUAA_RHOBA      ----------------------------------------------------------------------
GUAA_EUBE2      ----------------------------------------------------------------------
GUAA_ARCB4      ----------------------------------------------------------------------
GUAAA_METTP     ----------------------------------------------------------------------
TRPG_ARCFU      ----------------------------------------------------------------------
GUAA_THETN      ----------------------------------------------------------------------
GUAA_THEAB      ----------------------------------------------------------------------
GUAA_RHISN      ----------------------------------------------------------------------
GUAA_RHILW      ----------------------------------------------------------------------
GUAA_MICLC      ----------------------------------------------------------------------
GUAA_HERAR      ----------------------------------------------------------------------
GUAA_CHLT3      ----------------------------------------------------------------------
TRPE_AZOBR      ----------------------------------------------------------------------
GUAA_STRPG      ----------------------------------------------------------------------
GUAA_PROM5      ----------------------------------------------------------------------
GUAA_LISW6      ----------------------------------------------------------------------
GUAA_DEIDV      ----------------------------------------------------------------------
GUAA_COXBU      ----------------------------------------------------------------------
GUAA_COXBR      ----------------------------------------------------------------------
GUAA_COXB2      ----------------------------------------------------------------------
GUAA_COXB1      ----------------------------------------------------------------------
GUAA_COREF      ----------------------------------------------------------------------
TRPG_NEUCR      ----------------------------------------------------------------------
TRPG_METTH      ----------------------------------------------------------------------
GUAA_XYLFA      ----------------------------------------------------------------------
GUAA_WOLSU      ----------------------------------------------------------------------
GUAA_STRU0      ----------------------------------------------------------------------
GUAA_STRT2      ----------------------------------------------------------------------
GUAA_STRT1      ----------------------------------------------------------------------
GUAA_STAES      ----------------------------------------------------------------------
GUAA_STAEQ      ----------------------------------------------------------------------
GUAA_GEOKA      ----------------------------------------------------------------------
GUAA_CORDI      ----------------------------------------------------------------------
GUAA_CARHZ      ----------------------------------------------------------------------
GUAAA_HALSA     ----------------------------------------------------------------------
TRPG_ASPNG      ----------------------------------------------------------------------
GUAA_THEM4      ----------------------------------------------------------------------
GUAA_STACT      ----------------------------------------------------------------------
GUAA_RHOPA      ----------------------------------------------------------------------
GUAA_HELAH      ----------------------------------------------------------------------
GUAA_CORJK      ----------------------------------------------------------------------
GUAA_CLOCE      ----------------------------------------------------------------------
GUAA_CAMFF      ----------------------------------------------------------------------
GUAA_BACP2      ----------------------------------------------------------------------
GUAA_AGRVS      ----------------------------------------------------------------------
TRPG_METTM      ----------------------------------------------------------------------
GUAA_STRPZ      ----------------------------------------------------------------------
GUAA_STRPM      ----------------------------------------------------------------------
GUAA_STRPF      ----------------------------------------------------------------------
GUAA_STRPD      ----------------------------------------------------------------------
GUAA_STRPC      ----------------------------------------------------------------------
GUAA_STRPB      ----------------------------------------------------------------------
GUAA_STRP8      ----------------------------------------------------------------------
GUAA_STRP6      ----------------------------------------------------------------------
GUAA_STRP1      ----------------------------------------------------------------------
GUAA_STRAW      ----------------------------------------------------------------------
GUAA_STAS1      ----------------------------------------------------------------------
GUAA_RHOP2      ----------------------------------------------------------------------
GUAA_PROMP      ----------------------------------------------------------------------
GUAA_NOSP7      ----------------------------------------------------------------------
GUAA_LEGPH      ----------------------------------------------------------------------
TRPG_THET8      ----------------------------------------------------------------------
GUAA_STRP3      ----------------------------------------------------------------------
GUAA_NITHX      ----------------------------------------------------------------------
GUAA_AGRRK      ----------------------------------------------------------------------
GUAAA_PICTO     ----------------------------------------------------------------------
TRPG_EMENI      ----------------------------------------------------------------------
PABS_SCHPO      ----------------------------------------------------------------------
GUAA_WOLPP      ----------------------------------------------------------------------
GUAA_STAAB      ----------------------------------------------------------------------
GUAA_LACLS      ----------------------------------------------------------------------
GUAA_LACLM      ----------------------------------------------------------------------
GUAA_CAMHC      ----------------------------------------------------------------------
GUAAA_HALWD     ----------------------------------------------------------------------
GUAA_WOLTR      ----------------------------------------------------------------------
GUAA_THEEB      ----------------------------------------------------------------------
GUAA_PROM0      ----------------------------------------------------------------------
GUAA_COXBN      ----------------------------------------------------------------------
GUAA_CLOPE      ----------------------------------------------------------------------
GUAA_CLOB8      ----------------------------------------------------------------------
GUAA_ANAVT      ----------------------------------------------------------------------
TRPG1_HALMA     ----------------------------------------------------------------------
GUAA_STAHJ      ----------------------------------------------------------------------
GUAA_SALRD      ----------------------------------------------------------------------
GUAA_RHIME      ----------------------------------------------------------------------
GUAA_PROMS      ----------------------------------------------------------------------
GUAA_MACCJ      ----------------------------------------------------------------------
GUAA_HELPS      ----------------------------------------------------------------------
GUAA_EUBR3      ----------------------------------------------------------------------
GUAA_ENTFA      ----------------------------------------------------------------------
GUAA_DESAD      ----------------------------------------------------------------------
GUAA_CYAP7      ----------------------------------------------------------------------
GUAA_BACHD      ----------------------------------------------------------------------
GUAAA_THEVO     ----------------------------------------------------------------------
GUAAA_PYRFU     ----------------------------------------------------------------------
GUAAA_ARCFU     ----------------------------------------------------------------------
GUAA_RHIL3      ----------------------------------------------------------------------
GUAA_CHLPB      ----------------------------------------------------------------------
GUAA_BARQU      ----------------------------------------------------------------------
GUAA_BACSK      ----------------------------------------------------------------------
TRPG_CORGL      ----------------------------------------------------------------------
GUAA_SINMW      ----------------------------------------------------------------------
GUAA_PROMT      ----------------------------------------------------------------------
GUAA_PEDPA      ----------------------------------------------------------------------
GUAA_HELPY      ----------------------------------------------------------------------
GUAA_DEIRA      ----------------------------------------------------------------------
GUAA_CLOBL      ----------------------------------------------------------------------
GUAA_CLOBK      ----------------------------------------------------------------------
GUAA_CLOBJ      ----------------------------------------------------------------------
GUAA_CLOBH      ----------------------------------------------------------------------
GUAA_CLOB6      ----------------------------------------------------------------------
GUAA_CLOB1      ----------------------------------------------------------------------
GUAA_CAMLR      ----------------------------------------------------------------------
GUAAA_METTH     ----------------------------------------------------------------------
GUAA_PROM1      ----------------------------------------------------------------------
GUAA_LACLA      ----------------------------------------------------------------------
GUAA_ZYMMO      ----------------------------------------------------------------------
GUAA_STRS7      ----------------------------------------------------------------------
GUAA_STRE4      ----------------------------------------------------------------------
GUAA_HELPJ      ----------------------------------------------------------------------
GUAA_HELPH      ----------------------------------------------------------------------
GUAA_HELHP      ----------------------------------------------------------------------
GUAA_DESVM      ----------------------------------------------------------------------
GUAA_CYAA5      ----------------------------------------------------------------------
GUAA_CLOBM      ----------------------------------------------------------------------
GUAA_CAMJE      ----------------------------------------------------------------------
GUAA_ANASP      ----------------------------------------------------------------------
GUAA_STRCO      ----------------------------------------------------------------------
GUAA_LACS1      ----------------------------------------------------------------------
GUAA_DEHSC      ----------------------------------------------------------------------
GUAA_CAMJR      ----------------------------------------------------------------------
GUAA_BORBU      ----------------------------------------------------------------------
GUAA_BDEBA      ----------------------------------------------------------------------
GUAA_ASPFU      ----------------------------------------------------------------------
GUAA_ALCBS      ----------------------------------------------------------------------
TRPG_PICAN      ----------------------------------------------------------------------
TRPG_CLOTM      ----------------------------------------------------------------------
GUAA_LEIXX      ----------------------------------------------------------------------
GUAA_CLOD6      ----------------------------------------------------------------------
GUAA_CAMJJ      ----------------------------------------------------------------------
GUAA_CAMJD      ----------------------------------------------------------------------
TRPG_VIBPA      ----------------------------------------------------------------------
GUAA_VIBSL      ----------------------------------------------------------------------
GUAA_PROM9      ----------------------------------------------------------------------
GUAA_MYCPE      ----------------------------------------------------------------------
GUAA_MOOTA      ----------------------------------------------------------------------
GUAA_LACSS      ----------------------------------------------------------------------
GUAA_CAMJ8      ----------------------------------------------------------------------
GUAA_ASHGO      ----------------------------------------------------------------------
GUAA_AGRT5      ----------------------------------------------------------------------
GUAAA_METJA     ----------------------------------------------------------------------
TRPG_ECOLI      ----------------------------------------------------------------------
TRPG_ASPAW      ----------------------------------------------------------------------
GUAA_SYNWW      ----------------------------------------------------------------------
GUAA_RHILO      ----------------------------------------------------------------------
GUAA_PROMA      ----------------------------------------------------------------------
GUAA_PHOPR      ----------------------------------------------------------------------
GUAA_NITMU      ----------------------------------------------------------------------
GUAA_HELPG      ----------------------------------------------------------------------
GUAA_AQUAE      ----------------------------------------------------------------------
TRPG_SHIDY      ----------------------------------------------------------------------
GUAA_VIBFM      ----------------------------------------------------------------------
GUAA_VIBF1      ----------------------------------------------------------------------
GUAA_SYNY3      ----------------------------------------------------------------------
GUAA_MYCLE      ----------------------------------------------------------------------
GUAA_MYCLB      ----------------------------------------------------------------------
GUAA_LACPL      ----------------------------------------------------------------------
GUAA_HELP2      ----------------------------------------------------------------------
GUAA_DESVV      ----------------------------------------------------------------------
GUAA_DESVH      ----------------------------------------------------------------------
GUAA_DESPS      ----------------------------------------------------------------------
GUAA_ALISL      ----------------------------------------------------------------------
GUAA_VIBHB      ----------------------------------------------------------------------
GUAA_THERP      ----------------------------------------------------------------------
GUAA_PROM2      ----------------------------------------------------------------------
GUAA_HALOH      ----------------------------------------------------------------------
GUAA_DESDG      ----------------------------------------------------------------------
GUAA_DEHE1      ----------------------------------------------------------------------
GUAA_CLOTH      ----------------------------------------------------------------------
GUAA_BRASO      ----------------------------------------------------------------------
GUAAA_METM7     ----------------------------------------------------------------------
GUAA_SYNPX      ----------------------------------------------------------------------
GUAA_AERHH      ----------------------------------------------------------------------
GUAAA_METVS     ----------------------------------------------------------------------
TRPG_CYACA      ----------------------------------------------------------------------
GUAA_SYNSC      ----------------------------------------------------------------------
GUAA_SYNS9      ----------------------------------------------------------------------
GUAA_RALEJ      ----------------------------------------------------------------------
GUAA_NOCFA      ----------------------------------------------------------------------
GUAA_CAEEL      ----------------------------------------------------------------------
GUAA_BARHE      ----------------------------------------------------------------------
GUAA_ACIAD      ----------------------------------------------------------------------
GUAA_VIBVY      ----------------------------------------------------------------------
GUAA_VIBVU      ----------------------------------------------------------------------
GUAA_VIBCM      ----------------------------------------------------------------------
GUAA_VIBCH      ----------------------------------------------------------------------
GUAA_VIBC3      ----------------------------------------------------------------------
GUAA_PELPB      ----------------------------------------------------------------------
GUAA_OLICO      ----------------------------------------------------------------------
GUAA_HAHCH      ----------------------------------------------------------------------
GUAA_FINM2      ----------------------------------------------------------------------
GUAA_AERS4      ----------------------------------------------------------------------
TRPG_YERPE      ----------------------------------------------------------------------
PYRG_PSEF5      ----------------------------------------------------------------------
GUAA_TOLAT      ----------------------------------------------------------------------
GUAA_SPIKU      ----------------------------------------------------------------------
GUAA_PSEA6      ----------------------------------------------------------------------
GUAA_NITWN      ----------------------------------------------------------------------
GUAA_NATTJ      ----------------------------------------------------------------------
GUAA_CHLCV      ----------------------------------------------------------------------
TRPG_SALTY      ----------------------------------------------------------------------
TRPG_HALVO      ----------------------------------------------------------------------
GUAA_VESOH      ----------------------------------------------------------------------
GUAA_PSEAE      ----------------------------------------------------------------------
GUAA_PSEAB      ----------------------------------------------------------------------
GUAA_PSEA8      ----------------------------------------------------------------------
GUAA_MYCMM      ----------------------------------------------------------------------
GUAA_LACRH      ----------------------------------------------------------------------
GUAA_LACCB      ----------------------------------------------------------------------
GUAA_LACC3      ----------------------------------------------------------------------
GUAA_ENT38      ----------------------------------------------------------------------
GUAA_CHLMU      ----------------------------------------------------------------------
GUAAA_THEAC     ----------------------------------------------------------------------
PYRG_PSEPF      ----------------------------------------------------------------------
GUAA_VIBPA      ----------------------------------------------------------------------
GUAA_THIDA      ----------------------------------------------------------------------
GUAA_THET8      ----------------------------------------------------------------------
GUAA_THET2      ----------------------------------------------------------------------
GUAA_SALTY      ----------------------------------------------------------------------
GUAA_CHLFF      ----------------------------------------------------------------------
GUAA_BLOPB      ----------------------------------------------------------------------
GUAA_TREDE      ----------------------------------------------------------------------
GUAA_BURP8      ----------------------------------------------------------------------
GUAA_XANOR      ----------------------------------------------------------------------
GUAA_XANOP      ----------------------------------------------------------------------
GUAA_XANOM      ----------------------------------------------------------------------
GUAA_XANCP      ----------------------------------------------------------------------
GUAA_XANCB      ----------------------------------------------------------------------
GUAA_XANC8      ----------------------------------------------------------------------
GUAA_XANC5      ----------------------------------------------------------------------
GUAA_XANAC      ----------------------------------------------------------------------
GUAA_STRMK      ----------------------------------------------------------------------
GUAA_STRM5      ----------------------------------------------------------------------
GUAA_PROVI      ----------------------------------------------------------------------
GUAA_PROM3      ----------------------------------------------------------------------
GUAA_PROAC      ----------------------------------------------------------------------
GUAA_PHOLL      ----------------------------------------------------------------------
GUAA_PHEZH      ----------------------------------------------------------------------
GUAA_PELPD      ----------------------------------------------------------------------
GUAA_ALTMD      ----------------------------------------------------------------------
GUAAA_METMP     ----------------------------------------------------------------------
GUAA_YERPY      ----------------------------------------------------------------------
GUAA_YERPS      ----------------------------------------------------------------------
GUAA_YERPP      ----------------------------------------------------------------------
GUAA_YERPN      ----------------------------------------------------------------------
GUAA_YERPG      ----------------------------------------------------------------------
GUAA_YERPE      ----------------------------------------------------------------------
GUAA_YERPB      ----------------------------------------------------------------------
GUAA_YERPA      ----------------------------------------------------------------------
GUAA_YERP3      ----------------------------------------------------------------------
GUAA_YERE8      ----------------------------------------------------------------------
GUAA_SALAR      ----------------------------------------------------------------------
GUAA_KLEP7      ----------------------------------------------------------------------
GUAA_KLEP3      ----------------------------------------------------------------------
GUAA_GIBZE      ----------------------------------------------------------------------
GUAA_FRATW      ----------------------------------------------------------------------
GUAA_CLOAB      ----------------------------------------------------------------------
GUAA_CHLL2      ----------------------------------------------------------------------
GUAAA_METM6     ----------------------------------------------------------------------
GUAA_SERP5      ----------------------------------------------------------------------
GUAA_RALME      ----------------------------------------------------------------------
GUAA_PSEHT      ----------------------------------------------------------------------
GUAA_PASMU      ----------------------------------------------------------------------
GUAA_IDILO      ----------------------------------------------------------------------
GUAA_FRATT      ----------------------------------------------------------------------
GUAA_FRAT1      ----------------------------------------------------------------------
GUAA_EXIS2      ----------------------------------------------------------------------
GUAA_ESCF3      ----------------------------------------------------------------------
GUAA_ECO27      ----------------------------------------------------------------------
GUAA_BRAHW      ----------------------------------------------------------------------
GUAA_BLOFL      ----------------------------------------------------------------------
GUAAA_METM5     ----------------------------------------------------------------------
Y1171_HAEIN     ----------------------------------------------------------------------
TRPG_SERMA      ----------------------------------------------------------------------
GUAA_SHISS      ----------------------------------------------------------------------
GUAA_SHIDS      ----------------------------------------------------------------------
GUAA_SHIBS      ----------------------------------------------------------------------
GUAA_SHIB3      ----------------------------------------------------------------------
GUAA_SALTI      ----------------------------------------------------------------------
GUAA_SALSV      ----------------------------------------------------------------------
GUAA_SALPK      ----------------------------------------------------------------------
GUAA_SALPC      ----------------------------------------------------------------------
GUAA_SALPB      ----------------------------------------------------------------------
GUAA_SALPA      ----------------------------------------------------------------------
GUAA_SALNS      ----------------------------------------------------------------------
GUAA_SALHS      ----------------------------------------------------------------------
GUAA_SALG2      ----------------------------------------------------------------------
GUAA_SALEP      ----------------------------------------------------------------------
GUAA_SALDC      ----------------------------------------------------------------------
GUAA_SALCH      ----------------------------------------------------------------------
GUAA_SALA4      ----------------------------------------------------------------------
GUAA_PSEPK      ----------------------------------------------------------------------
GUAA_PSEPG      ----------------------------------------------------------------------
GUAA_PSEP1      ----------------------------------------------------------------------
GUAA_PSEMY      ----------------------------------------------------------------------
GUAA_PHANO      ----------------------------------------------------------------------
GUAA_NEIG2      ----------------------------------------------------------------------
GUAA_HAMD5      ----------------------------------------------------------------------
GUAA_HAES2      ----------------------------------------------------------------------
GUAA_GLOVI      ----------------------------------------------------------------------
GUAA_ECOUT      ----------------------------------------------------------------------
GUAA_ECOSM      ----------------------------------------------------------------------
GUAA_ECOSE      ----------------------------------------------------------------------
GUAA_ECOLU      ----------------------------------------------------------------------
GUAA_ECOLI      ----------------------------------------------------------------------
GUAA_ECOLC      ----------------------------------------------------------------------
GUAA_ECOL6      ----------------------------------------------------------------------
GUAA_ECOL5      ----------------------------------------------------------------------
GUAA_ECOK1      ----------------------------------------------------------------------
GUAA_ECOHS      ----------------------------------------------------------------------
GUAA_ECODH      ----------------------------------------------------------------------
GUAA_ECOBW      ----------------------------------------------------------------------
GUAA_ECO8A      ----------------------------------------------------------------------
GUAA_ECO81      ----------------------------------------------------------------------
GUAA_ECO7I      ----------------------------------------------------------------------
GUAA_ECO5E      ----------------------------------------------------------------------
GUAA_ECO57      ----------------------------------------------------------------------
GUAA_ECO55      ----------------------------------------------------------------------
GUAA_ECO45      ----------------------------------------------------------------------
GUAA_ECO24      ----------------------------------------------------------------------
GUAA_CHRVO      ----------------------------------------------------------------------
GUAA_CHLTE      ----------------------------------------------------------------------
GUAA_BRUSU      ----------------------------------------------------------------------
GUAA_BRUSI      ----------------------------------------------------------------------
GUAA_BRUO2      ----------------------------------------------------------------------
GUAA_BRUME      ----------------------------------------------------------------------
GUAA_BRUMB      ----------------------------------------------------------------------
GUAA_BRUC2      ----------------------------------------------------------------------
GUAA_BRUAB      ----------------------------------------------------------------------
GUAA_BRUA2      ----------------------------------------------------------------------
GUAA_BRUA1      ----------------------------------------------------------------------
GUAA_BRAJA      ----------------------------------------------------------------------
GUAA_BARBK      ----------------------------------------------------------------------
GUAA_ANAMM      ----------------------------------------------------------------------
GUAA_ANAMF      ----------------------------------------------------------------------
GUAAA_METS3     ----------------------------------------------------------------------
GUAAA_METKA     ----------------------------------------------------------------------
TRPG_SCHPO      ----------------------------------------------------------------------
PYRG_PSESM      ----------------------------------------------------------------------
PYRG_PSE14      ----------------------------------------------------------------------
PYRG_LACJO      ----------------------------------------------------------------------
GUAA_SHIFL      ----------------------------------------------------------------------
GUAA_SHIF8      ----------------------------------------------------------------------
GUAA_PSYIN      ----------------------------------------------------------------------
GUAA_MYCTU      ----------------------------------------------------------------------
GUAA_MYCTA      ----------------------------------------------------------------------
GUAA_MYCBT      ----------------------------------------------------------------------
GUAA_MYCBP      ----------------------------------------------------------------------
GUAA_MYCBO      ----------------------------------------------------------------------
GUAA_GEOSL      ----------------------------------------------------------------------
GUAA_CITK8      ----------------------------------------------------------------------
GUAAA_HALMA     ----------------------------------------------------------------------
PYRG_RICFE      ----------------------------------------------------------------------
PYRG_PSEFS      ----------------------------------------------------------------------
GUAA_SODGM      ----------------------------------------------------------------------
GUAA_RALEH      ----------------------------------------------------------------------
GUAA_PSEE4      ----------------------------------------------------------------------
GUAA_PROMM      ----------------------------------------------------------------------
GUAA_PROMH      ----------------------------------------------------------------------
GUAA_NITEC      ----------------------------------------------------------------------
GUAA_MANSM      ----------------------------------------------------------------------
GUAA_HELMI      ----------------------------------------------------------------------
GUAA_HAES1      ----------------------------------------------------------------------
GUAA_GEOSF      ----------------------------------------------------------------------
GUAA_CANGA      ----------------------------------------------------------------------
GUAA_ACTSZ      ----------------------------------------------------------------------
GUAAA_NATPD     ----------------------------------------------------------------------
PYRG_TOLAT      ----------------------------------------------------------------------
PYRG_ENTFA      ----------------------------------------------------------------------
GUAA_POLSQ      ----------------------------------------------------------------------
GUAA_POLNS      ----------------------------------------------------------------------
GUAA_NITOC      ----------------------------------------------------------------------
GUAA_HAEPS      ----------------------------------------------------------------------
GUAA_GEOMG      ----------------------------------------------------------------------
GUAA_FRATO      ----------------------------------------------------------------------
GUAA_FRATN      ----------------------------------------------------------------------
GUAA_FRATH      ----------------------------------------------------------------------
GUAA_FRATF      ----------------------------------------------------------------------
GUAA_BURCJ      ----------------------------------------------------------------------
GUAA_ACTPJ      ----------------------------------------------------------------------
GUAA_ACTP7      ----------------------------------------------------------------------
GUAA_ACTP2      ----------------------------------------------------------------------
PYRG_PSEU2      ----------------------------------------------------------------------
PYRG_OCEIH      ----------------------------------------------------------------------
GUAA_TERTT      ----------------------------------------------------------------------
GUAA_SHELP      ----------------------------------------------------------------------
GUAA_RHORT      ----------------------------------------------------------------------
GUAA_PSEU2      ----------------------------------------------------------------------
GUAA_PSEPW      ----------------------------------------------------------------------
GUAA_PELCD      ----------------------------------------------------------------------
GUAA_NITEU      ----------------------------------------------------------------------
GUAA_METCA      ----------------------------------------------------------------------
GUAA_GLUOX      ----------------------------------------------------------------------
GUAA_FRASN      ----------------------------------------------------------------------
GUAA_AERPE      ----------------------------------------------------------------------
TRPG_PHACH      ----------------------------------------------------------------------
GUAA_USTMA      ----------------------------------------------------------------------
GUAA_SHEPW      ----------------------------------------------------------------------
GUAA_SHEDO      ----------------------------------------------------------------------
GUAA_NEIG1      ----------------------------------------------------------------------
GUAA_METFK      ----------------------------------------------------------------------
GUAA_EDWI9      ----------------------------------------------------------------------
GUAA_CHLPD      ----------------------------------------------------------------------
GUAA_CELJU      ----------------------------------------------------------------------
GUAA_AZOSB      ----------------------------------------------------------------------
TRPG_VIBCH      ----------------------------------------------------------------------
PYRG_LACPL      ----------------------------------------------------------------------
PYRG_AZOVD      ----------------------------------------------------------------------
PHZE_PSEFL      ----------------------------------------------------------------------
GUAA_SYMTH      ----------------------------------------------------------------------
GUAA_SHEPA      ----------------------------------------------------------------------
GUAA_SHEHH      ----------------------------------------------------------------------
GUAA_RALPJ      ----------------------------------------------------------------------
GUAA_PELLD      ----------------------------------------------------------------------
GUAA_HAEDU      ----------------------------------------------------------------------
GUAA_FRATM      ----------------------------------------------------------------------
GUAA_DECAR      ----------------------------------------------------------------------
GUAA_CUPTR      ----------------------------------------------------------------------
GUAA_BURXL      ----------------------------------------------------------------------
GUAA_BURPP      ----------------------------------------------------------------------
GUAAA_SULSO     ----------------------------------------------------------------------
PYRG_CHLTR      ----------------------------------------------------------------------
PYRG_CHLTB      ----------------------------------------------------------------------
PYRG_CHLTA      ----------------------------------------------------------------------
PYRG_CHLT2      ----------------------------------------------------------------------
GUAA_SHEWM      ----------------------------------------------------------------------
GUAA_PETMO      ----------------------------------------------------------------------
GUAA_MYCPA      ----------------------------------------------------------------------
GUAA_CHLCH      ----------------------------------------------------------------------
GUAA_BURM1      ----------------------------------------------------------------------
GUAA_BURCM      ----------------------------------------------------------------------
GUAA_BURA4      ----------------------------------------------------------------------
TRPG_HALSA      ----------------------------------------------------------------------
TRPG_BUCAP      ----------------------------------------------------------------------
PYRG_THICR      ----------------------------------------------------------------------
PYRG_LACAC      ----------------------------------------------------------------------
GUAA_SYNP6      ----------------------------------------------------------------------
GUAA_SHEFN      ----------------------------------------------------------------------
GUAA_PSYA2      ----------------------------------------------------------------------
GUAA_PSESM      ----------------------------------------------------------------------
GUAA_PSE14      ----------------------------------------------------------------------
GUAA_NEIMB      ----------------------------------------------------------------------
GUAA_KLULA      ----------------------------------------------------------------------
GUAA_ENTS8      ----------------------------------------------------------------------
GUAA_AZOSE      ----------------------------------------------------------------------
GUAAA_META3     ----------------------------------------------------------------------
GUAAA_IGNH4     ----------------------------------------------------------------------
TRPG_HELPY      ----------------------------------------------------------------------
PYRG_LACSS      ----------------------------------------------------------------------
GUAA_SYNS3      ----------------------------------------------------------------------
GUAA_PSEFS      ----------------------------------------------------------------------
GUAA_PSEF5      ----------------------------------------------------------------------
GUAA_PECCP      ----------------------------------------------------------------------
GUAA_NEIMF      ----------------------------------------------------------------------
GUAA_NEIMA      ----------------------------------------------------------------------
GUAA_NEIM0      ----------------------------------------------------------------------
GUAA_MARAV      ----------------------------------------------------------------------
GUAA_ERWCT      ----------------------------------------------------------------------
GUAA_BURPS      ----------------------------------------------------------------------
GUAA_BURP1      ----------------------------------------------------------------------
TRPG_HELPJ      ----------------------------------------------------------------------
PYRG_STAHJ      ----------------------------------------------------------------------
PYRG_LACBA      ----------------------------------------------------------------------
PYRG_BACLD      ----------------------------------------------------------------------
PHZB_PSECL      ----------------------------------------------------------------------
GUAA_YEAST      ----------------------------------------------------------------------
GUAA_BURP6      ----------------------------------------------------------------------
GUAA_BURP0      ----------------------------------------------------------------------
GUAA_BURMS      ----------------------------------------------------------------------
GUAA_BURMA      ----------------------------------------------------------------------
GUAA_BURM9      ----------------------------------------------------------------------
GUAA_BURM7      ----------------------------------------------------------------------
GUAA_BURCH      ----------------------------------------------------------------------
GUAA_BURCC      ----------------------------------------------------------------------
GUAA_BURCA      ----------------------------------------------------------------------
PYRG_PSEU5      ----------------------------------------------------------------------
PYRG_PSEMY      ----------------------------------------------------------------------
GUAA_SHESR      ----------------------------------------------------------------------
GUAA_SHESM      ----------------------------------------------------------------------
GUAA_SHESA      ----------------------------------------------------------------------
GUAA_SHEON      ----------------------------------------------------------------------
GUAA_PSEPF      ----------------------------------------------------------------------
GUAA_HAEIG      ----------------------------------------------------------------------
GUAA_FRAP2      ----------------------------------------------------------------------
GUAA_EMENI      ----------------------------------------------------------------------
GUAA_CHLPN      ----------------------------------------------------------------------
GUAAA_SULTO     ----------------------------------------------------------------------
PYRG_PHOLL      ----------------------------------------------------------------------
GUAA_RHOPB      ----------------------------------------------------------------------
GUAA_COLP3      ----------------------------------------------------------------------
GUAAA_METB6     ----------------------------------------------------------------------
YA14_SCHPO      ----------------------------------------------------------------------
TRPG_CRYNE      ----------------------------------------------------------------------
PYRG_ERWT9      ----------------------------------------------------------------------
HIS5_HALMA      ----------------------------------------------------------------------
GUAA_METPP      ----------------------------------------------------------------------
GUAA_CAUCR      ----------------------------------------------------------------------
GUAA_CAUCN      ----------------------------------------------------------------------
YL126_YEAST     ----------------------------------------------------------------------
TRPG_CRYNV      ----------------------------------------------------------------------
PYRG_YERPY      ----------------------------------------------------------------------
PYRG_YERPS      ----------------------------------------------------------------------
PYRG_YERPP      ----------------------------------------------------------------------
PYRG_YERPN      ----------------------------------------------------------------------
PYRG_YERPG      ----------------------------------------------------------------------
PYRG_YERPE      ----------------------------------------------------------------------
PYRG_YERPB      ----------------------------------------------------------------------
PYRG_YERPA      ----------------------------------------------------------------------
PYRG_YERP3      ----------------------------------------------------------------------
PYRG_STRA3      ----------------------------------------------------------------------
PYRG_STRA1      ----------------------------------------------------------------------
PYRG_LISMO      ----------------------------------------------------------------------
PYRG_EDWI9      ----------------------------------------------------------------------
PYRG_AERHH      ----------------------------------------------------------------------
GUAA_SHESW      ----------------------------------------------------------------------
GUAA_SHEPC      ----------------------------------------------------------------------
GUAA_SHEAM      ----------------------------------------------------------------------
GUAA_BAUCH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
CARA_ECOLI      ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
CARA_ECO57      ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
CARA_ECOL6      ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
CARA_SALTY      ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDA
CARA_SALTI      ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDA
CARA_YERPS      ESSAVHAQGLVIRDLPLIASNYRNEEGLSEYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIVGELSDA
CARA_YERPE      ESSAVHAQGLVIRDLPLIASNYRNEEGLSEYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIVGELSDA
CARA_ERWCT      ESPSVQAQGLVIRDLPLIASNYRSEESLSEYLKRNNIVAIADIDTRKLTRLLREKGAQNGCIIAGDAPDA
CARA_PHOLL      ESLKVQAQGLVIRDLPLLTSNFRCEETLSDYLKRHNIVAIADIDTRKLTRLLREKGSQNGCIIAGKQIDA
CARA_VIBCH      ESTAIHAQGLVIRDLPLIASNFRSEQSLSDYLKSQNIVGIADIDTRKLTRILREKGAQNGCIMAGDNLDX
CARA_VIBPA      ESSSIHAQGLVIRDLPLIASNFRNEQSLSDYLKSQNIVGIADIDTRKLTRILREKGAQNGCIVAGNNLDX
CARA_PHOPR      ESNSIHAQGLVIRDLPLLASNFRNERSLSDYLKSQNIVGIAEIDTRKLTRILREKGAQNGCIMAGDNLDE
CARA_VIBVU      XXXXIHAQGLVIRDLPLIASNFRSEQSLSDYLKSQNIVGIADIDTRKLTRILREKGAQNGCIVAGNNLDX
CARA_VIBVY      XXXXIHAQGLVIRDLPLIASNFRSEQSLSDYLKSQNIVGIADIDTRKLTRILREKGAQNGCIVAGNNLDX
CARA_SHEON      ESNGVHACGLIIRDLPLIASSFRNQQNLSDYLKANNVVGIADIDTRKLTRILREKGAQAGCIMAGADLDE
CARA_THISH      ESAGVHAAGLVIRDLPPLVSSWRSRESLPDYLTRFGVVAIANIDTRRLTRILREKGAQNGCIMAGEIDEQ
CARA_PSEPK      ESSRVWSAGLVIRDLPLLASNWRNTQSLPEYLKANNVVAIAGIDTRRLTRILREKGAQNGCILAGDNISE
CARA_PSEAE      EANRVWAAGLIIRDLPLIASNWRSKQSLPDYLKANGTVAIAGIDTRRLTRILREKGSQNGCILAGADATX
CARA_TERTT      ECKTIWATGLVIRDLPLLASNFRNSQSLDQYLSSKNILGIADIDXXXXXXXXXDKGALAGCIMAGD-VDE
CARA_ACIAD      ESGRIHANGLIIRDLPLLHSNFRSEQSLAEYLIQHNVVAIADIDTRKLTRILRDKGAQNGCILAGENITE
CARA_PSEST      ESWKVWAAGLVIRDLPLLASNWRNKQSLPDYLKENDTVAIAGIDTRRLTRILREKGAQNGCILAGADATE
CARA_HALER      ESSSIAAAGLVIRDLPLLASSFRCEQSMSDYLAQQNVLGIADMHTRRLTRLLRDKGSQNGAIXXXXXXXX
CARA_BUCAI      ESSKIYIKGLIIRDLSLTASNYRNKKSFSSYLKENNIIAISDIDTRKLTRILRTKGSQNGCIIEDKKQNY
CARA_BUCAP      ESSKIHIRGLIIRDMSPISSNYRSEKSFSSYLKENNIVAISDIDTRKLTRILRTKGSQNGCIIEDKKENY
CARA_PSESM      ESDRVWSAGLVIRDLPLVASNWRNKMSLGDYLKANNVVAIAGIDTRRLTRILREKGAQNGCIMAGDNISE
CARA_RALSO      EATKVHAAGLIIKDLPILASNFRQEHSLSHYLKGEKVVAIAGIDTRKLTRILREKGAQNGCVLAGDNPQK
CARA_NEIMB      ESRSVYAAGLIIRDLPLLHSNFRASESLHDYLVRNKTVAIADIDTRRLTTLLREKGAQGGAILTGADATI
CARA_NEIMA      ESRSVYAAGLIIRDLPLLHSNFRASESLHDYLVRNKTVAIADIDTRRLTTLLREKGAQGGAILTGADATI
CARA_HAEDU      ESNQIYASGLIIRDLPLLHSNFRATSSLSDYLIQHNIIAIADIDTRRLTRILRETGSQAGCIIPNENESL
CARA_POLSQ      ESDRIHAAGLVIKDLPKRVSNFRSEAPLDAYLTEAGVVGIAGIDTRKLTRILRDKGAQSGAIVAGKAGDG
CARA_NEIGO      ESRSVYAAGLIIRDLPLLHSNFRASESLHDYLVRNETVAIADIDTRRLTMLLREKGAQGGAILTGADATV
CARA_PASMU      EANHVYASGLIIRDLPLLHSNFRSSMSLRDYLQTHNVVAIADIDTRRLTRILRDKGAQAGCIMTGEI-DE
CARA_XYLFA      EANKVWAAGLIVRDVPRRPSNWRSQISLSDWLAARGVVAIAGIDTRKLTRILREKGAQHGALMAGEI-DV
CARA_POLNS      ESDRIHAAGLVVKDLPKRVSSFRSEGALDDYLTKAGVLGIAGIDTRKLTRILRDKGAQSGAIVAGKVGDS
CARA_XYLFT      EANKVWAAGLIVRDVPRRPSNWRSQISLSDWLAARGVVAIAGIDTRKLTRILREKGAQHGALMAGEI-DV
CARA_XANCP      EAKQVWAAGLIVRDVPRRPSSWRNQVALPAWLQTRGVVAISGIDTRKLTRLLREKGAQNGALMAGEI-DV
CARA_RHOGE      EAAKVHAAGLVIKDLPLRVSNFRAAMPLSQYLEREGTVAIAGIDXXXXXXXXXXXGAQNGCIVSFGEXXX
CARA_XANAC      EARKIWAAGLIVRDVPRRPSNWRSQVALPEWLQARGVVAISGIDTRKLTRLLRQKGAQNGALMAGD-IDV
CARA_BUCBP      ESNVIHAKGLIVRDISSIYSNHRSQMSLLNYLLNQKIIVISNIDTRKLTRILRTTGSQYGYITTKKIHSI
CARA_OCHA4      EANRHGAVGAIFKADITSPSNFRATEDLDAWLKNRGVIALAGIDTRALTSLIRERGAQNA-VIAHD-PSG
CARA_BRUSU      EANRHGAVGAIFKADITAPSNFRAAEDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAHDPNGNF
CARA_BRUSI      EANRHGAVGAIFKADITAPSNFRAAEDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAHDPNGNF
CARA_BRUC2      EANRHGAVGAIFKADITAPSNFRAAEDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAHDPNGNF
CARA_BRUO2      EANRHGAVGAIFKADITAPSNFRAAKDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAHDPNGNF
CARA_BRUME      EANRHGAVGAIFKADITAPSNFRAAKDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAHDPNGNF
CARA_BRUMB      EANRHGAVGAIFKADITAPSNFRAAKDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAHDPNGNF
CARA_BRUAB      EANRHGAVGAIFKADITAPSNFRAAKDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAHDPNGNF
CARA_BRUA2      EANRHGAVGAIFKADITAPSNFRAAKDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAHDPNGNF
CARA_BRUA1      EANRHGAVGAIFKADITAPSNFRAAKDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAHDPNGNF
CARA_RHILO      EAARAGAVGAVFKADVTNPSNYRAAGHLDQWLKKRGIVALSGIDTRALTALIREKGMPNAVIAHA--PDG
CARA_BRAJA      ETVNMAARGVILRTAITDPSNYRATKHLDAWLKARGIIGLSGIDTRALTALIRSKGMPNAVIAHARNGEF
CARA_ZYMMO      EAKTLHALGCIVREDVTAPSNFRSLWRFDSWLKDHDRIGLAGVDTRALTGLLRKKGAQNA-VIAHDPKDI
CARA_BARQU      EDLNCHAVGAIFKADITYPSNYRANENLNQWLKTRKIIALCGVDTRALTVLIREKGSLNGIIIHDPNGNF
CARA_RHIME      EAARHGAVGVIFKADITEPSNYRAAKHLDAWLKARGIIGLCGIDTRALTAWIRENGMPNA-VIAHDPADV
CARA_BARHE      EDLNCHAVGAIFKADITHPSNYRANENLNQWLKKRKIIALCGIDTRALTVLIREKGALNG-IIAHDNFDI
CARA_AGRT5      EAARRGAVGVIFKADITDPSNFRAVKHLDAWLKARGVIGLCGIDTRALTAWIRENGAPNA-VIAHD-PNG
CARA_PROA2      ESQKIWASALIVREMSNIHSNFAATGSLDQYLKEAKVMGLAGIDTRKLVREIRQKGAMRGVISAID-PDE
CARA_CHLTE      ESKKIWASALIVREASNVYSNYESTRSLDATLKEAGVMGLAGIDTRKLVREIRQKGAMRA-VISTLCDDV
CARA_BART1      ESSCHGAVGAIFKADITHPSNYRASENLHQWLKARKIIALCGIDTRALTILIREKGTQNAVIASDGNFDI
CARA_SYNY3      ESIHPHVKGVVARNITRRPSNWRSTQSLPDYLVEHKIIGIYGIDTRALTRKLRSIGAMNGGISTEILEPE
CARA_RHOBA      ENRGTSLAGFIIRNESRMHSNYRSEGSLSDYLNSQGVVGIAGIDTRALVRRIRSEGAMRGVLSTTDLDDA
CARA_PELCD      ESGRPHLSGFIVKEACPYPSNWRSTTTLDDYLKQNQIVGIQGIDTRALVRHIRDNGAQTG-IISSIDLDP
CARA_BARBK      DLTPLHHYGAVIFKAHSSPSNYRANENLNQWLKKHQIIALCGIDTRALTALIREKGAQNA-VIAHDNFDI
CARA_WIGBR      XSSKIQVKAVILYQTHNIISDFRNKLSFSRFXXXXXXXXXXXXDTRKLTRLIRKSGTQYGYVSSGTNINF
CARA_ANASP      ESARPQVRGAIARNICHKPSNWRSTQSLPDYLKQHHIPGIFGIDTRALTRKIRMYGAMNGGI-STEILDE
CARA_SYNE7      ESARPQVSGLIARNVARRHSNWRADRSLPDYLQQHNIVGIYGIDTRALTQHLRSTGAMNGGISTTIDPEE
CARA_THEEB      ESDRPQVRGAVARNICDIPSNWRSQQSLPDYLKAHRIPAIYGIDTRALTRKIRTVGAMNGG-ISTEILDP
CARA_SYNP6      ESARPQVSGLIARNVARRHSNWRADRSLPDYLQQHNIVGIYGIDTRALTQHLRSTGAMNGGISTTIDPEE
CARA_SILPO      ETTDPVAAGMVVKWDPTAASNWRAAEELKGWLARRGRIAIGGVDTRRLTRAIRQQGAPH--VALAHDPDX
CARA_AQUAE      ESKSVQVNGFVVKEAFFRYSNWRAKKSLDEYLKENNVVGIYGIDTRALVKKIREKGSMKG-VISTVEKDP
CARA_PORPU      ESQTISIKGLVAKNICKISSSWRQQESLVQYLNRYKIPFIFGIDTRSLTQYLRRSGTMNGCI-SNKNLNH
CARA_LEPIN      ESSKIQASGLIVKEYVDLPSNFKSEKTLSQFLKEYKIPAIQGIDTRKLTRFIRTNGSPNGGIFVASEYSP
CARA_LEPIC      ESSKIQASGLIVKEYVDLPSNFKSEKTLSQFLKEYKIPAIQGIDTRKLTRFIRTNGSPNGGIFVASEYSP
CARA_SYNPX      EADHPHARGVIARQLAPCASNWRCSESLDNWMERHGLVGICGVDTRALVRRLRDGGAING-VISSDGRSP
CARA_MARMM      EAASPQARGMIARAKITPPASWRADTTFEEWLCTRGIVALTGIDTRALTRKIREGGMQM-CAIAHDNIDI
CARA_AKKM8      ESGKAQVSGFVVAELAKVHSNWRATESLGPWLEKQGVIGIEGVDTRKIAKHLRSAGAMRACLTTELTPEE
CARA_LEPBL      ESSKIQASGLIVREYVDLPSNFMSQKTLSKFLKEYQIPAIQGIDTRKLTRYIRTNGSPNGGIFVAREYSP
CARA_LEPBJ      ESSKIQASGLIVREYVDLPSNFMSQKTLSKFLKEYQIPAIQGIDTRKLTRYIRTNGSPNGGIFVAREYSP
CARA_CAUCR      EQAETAARGALFRDVPTVQANWRADGDFDAWMKARGVVGLAGVDTRALTRKIRETGMPHGVIAHSPDGDX
CARA_STRCO      ESRRIWVSGYVVRDPARVPSNWRSTRSLDQELAAQGVVGISGIDTRALTRHLRERGAMRVGIFSGNAPDE
CARA_DEIRA      ESNKPYVRGFISREFSGEYSNYRAQQSLEAFMQQYGVVSIQGIDTRALVRRLRSGGVVKGVITHPEDPEE
CARA_DEIGD      ESNKPYVRGFIAREFSGEYSNHRAQQSLEAFMQQYGVVSIQGIDTRALVRRLRTGGVVKGVITHPEDPEE
CARA_BACCL      EAIRPHVHGFIVKEACVKPSNWRGELTLDEYLKEKGIPGLSGIDTRKLTRLIRQYGTLKGMICGLDDPVE
CARA_DESAD      ESAKVHVAAFIVKECCKHPSNWRSVMSLPEYLKEAGVMGIEGIDTRALTRHLRINGAMRG-IISTEELDP
CARA_THEMA      ESDGIKVAGFVVYRSVDTPSNWRATMSFPDYLKKYNIVAIEGVDTRALTRKIRVKGAMKGAISTVDDPDS
CARA_STRAW      ESKRIWVSGYVVRDPARVPSNWRSRRSLDEELRHQGVVGISGIDTRALTRHLRESGAMRVGIFSGSAPDE
CARA_OCEIH      ETVTPFIHGLVVKEYSEFPSNFRNEETLDEFLQAHNIPGIANIDTRKLTRIIRKHGTMRA-VMVDEQKNE
CARA_SYNR3      EADTPAVKAVLCRCLAPQPSNWRSSGTLEQWLEQHGVVGLKGIDTRAVVRQLRDGGAINGA-VSTDGTSP
CARA_HYPNA      EESTVEARGAIFREPITAPSNWRSTEDFGVWLARRGIIGLSGIDTRALTKRIREKGMPKAAIC--HKPDG
CARA_HELHP      ESPRAACTGVILSSYNDFVSNFRSEQSLSTYLKEHNIMGICGVDTRNLIKMLTTQGAMMMIASTQITQES
CARA_STRR6      ESIIPTCKGVVVFEEARRASNWRNQMTLDEFLKAKKIPGISGIDTRALTKIIRKHGTMRATLTVGDSMDH
CARA_STRPN      ESIIPTCKGVVVFEEARRASNWRNQMTLDEFLKAKKIPGISGIDTRALTKIIRKHGTMRATLTVGDSMDH
CARA_LISMO      ESINPAVKGVVVREAAEFASNWRNQITLNEFLKEKGIPGIAGIDTRKLTKLIRKEGTLKG-ILAAETADK
CARA_CORDI      ESDKIWVAGLVIRDLSTAVSNWRAKRSLEDEMREQNIVGISGVDTRAIVRHLRNFGSVAAGIFSGEQPHD
CARA_BACHD      ESMNPAIHGLIVKEACDIPSNWRSEESLDSLLKAKQIPGLSGIDTRKLTRLIRMHGTLKGQLCPLD-VDV
CARA_ARCFU      ESDGVKVEGFVVKELCKNPSNWRSEMSVDELLKQYDVPGIEGVDTRMLTRKIRIYGSMKAAIGIGD-VDR
CARA_STRP6      ESISPTCKGVVVSEVSRLASNWRKQMTLDAFLKIKGIPGISGIDTRALTKIIRQHGTMKATM--ADDGDS
CARA_STRP3      ESISPTCKGVVVSEVSRLASNWRKQMTLDAFLKIKGIPGISGIDTRALTKIIRQHGTMKATM--ADDGDS
CARA_STRP1      ESISPTCKGVVVSEVSRLASNWRKQMTLDAFLKIKGIPGISGIDTRALTKIIRQHGTMKATM--ADDGDS
CARA_STAEQ      ESLTPKLNGVVVKEASTHPSNFRHQKTLHETLAQYHIPGISGVDTRSITRKIR----NHGVLRAGDNKD-
CARA_PORYE      ESHSISIKGLIAKNICKISSSWREQQSLVKYLSSNNIPFIFGIDTRSLTQYLRQFGTMNGC-ISTDNLNH
CARA_STRP8      ESISPTCKGVVVSEVSRLASNWRKQMTLDAFLKIKGIPGISGIDTRALTKIIRQHGTMKATM--ADDGDS
CARA_STAS1      EALVPTLNGVVVKEASRQPSNFRKQKTFHEVLQEYDIPGISGVDTRSITRKIR----NNGVLKAGFTDEK
CARA_STAHJ      EALTPTLNGVVVKEASTHPSNFRNQKTLHDVLVQYKIPGISGVDTRSITRKIRQHGVKAGFTDNRDDIDS
CARA_GRATL      ESNKIHVKGIITKNICFSPNNWRQQESFINYIFNNQIPHIFGIDTRALTKHLRKTGSMNGC-ISSQYLNP
CARA_BACSU      ESITPFVKGLIIKELCELPSNWRSAYTLDEYLKMKNIPGLQGIDTRKLTRMIRTAGALKGTFASSDE-DI
CARA_STAES      ESLTPKLNGVVVKEASTHPSNFRHQKTLHETLAQYHIPGISGVDTRSITRKIRNYGVLRAGFT--DNKD-
CARA_LISMF      ESINPAVKGVVVREAAEFPSNWRNQITLDEFLKEKGIPGIAGIDTRKLTKLIRKEGTLKG-ILAAETANK
CARA_FUSNN      ESMKPCIKGMVVKEVCATPSNFRSEKTLDEALKDFGIPGIYGIDTRALTRKLRSKGVVKGCLVSIDNVDE
CARA_BACCR      ESIHPSVNGLIVNEICNHPSNFRNEISLNDYLKERNIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDDVEY
CARA_LISIN      ESINPAVKGVVVREAAEYPSNWRNQITLNEFLKEKGIPGIAGIDTRKLTKLIRKEGTLKGILSAADKEEL
CARA_SYMTH      ESRQPWIRGLVVKELCDRPSHWQAVGSLSDYLAGCGVPILAGLDTRALTRHLRSHGTMRGVIATGAEPGP
CARA_STRMU      ESIKPTCKGVVVSENARRANNWRKQMTLDEFLKSKNIPGISGIDTRALTKIIRHHGTMKATLAEGDSIEH
CARA_STRA5      ESIRPTCKGVVIYEWAEYPSNWRQQMTLDEFLKLKGIPGISGIDTRALTKIIRKHGTMKACLINEGN-SI
CARA_STRA3      ESIRPTCKGVVIYEWAEYPSNWRQQMTLDEFLKLKGIPGISGIDTRALTKIIRKHGTMKACLINEGN-SI
CARA_CLOPE      ESKEPKVRGFIVREKCQYPNNFRCELELETYLAQNKVLGLDGIDTRALTKILRNNGTMKGIIVL-DNSNL
CARA_THET8      QSNRPWVRGFVAKEFSRVASNPRAQQTIGEFMEFYGVVGIEGIDTRALVRKIREGGVLKGTIAHASAPDH
CARA_THET2      QSNRPWVRGFVAKEFSRVASNPRAQQTIGEFMEFYGVVGIEGIDTRALVRKIREGGVLKGTIAHASAPDH
CARA_STAAW      ESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIR----QHGVLKAGDRKED
CARA_STAAS      ESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIR----QHGVLKAGDRKED
CARA_STAAR      ESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIR----QHGVLKAGDRKED
CARA_STAAN      ESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIR----QHGVLKAGDRKED
CARA_STAAM      ESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIR----QHGVLKAGDRKED
CARA_STAAC      ESLVPTLNGIVVKEASAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIR----QHGVLKAGDRKED
CARA_BACHK      ESIHPSVNGLIVNEICDHPSNFRNEISLNDYLKERNIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDDVEY
CARA_BACAN      ESIHPSVNGLIVNEICDHPSNFRNEISLNDYLKERNIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDDVEY
CARA_METKA      ESDRVQVEGFVVRYLHDGPIHPRAEITLDEFLQDHGVPGIAGVDTRMLTRKIRTEGAMRGVLVPDDQPSD
CARA_CLOAB      QSKCVYAKGFIVKNIDENPSNYTSEINIDQMLKNMGVVGVFGVDTRSITKKIRSYGTMK-CIIS----NG
CARA_LACPL      ESIKPTCKGVVVHEVARRASNWRNAQSLDDYLKQNAIPGIMDIDTRAVTKHIRTKGAMKATIVDNVLPDT
CARA_BACC1      ESIHPSVNGLIVNEICDHPSNFRNEISLNDYLKERNIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDDVEY
CARA_COREF      ESGSIWVAGLVIRDLAVRVSNWRATTTLQEEMAKQGVVGIGGIDTRALVRHIRNEGAVPAGIFSGADAER
CARA_BIFLI      ESSRIWVAGYIVRDPSPNVSNWRAEGSLDDDLTKNGIVGLSHIDTRKLVRHLRSAGVMRAGIFSGDQATG
CARA_BIFLO      ESSRIWVAGYIVRDPSPNVSNWRAEGSLDDDLAKNGIVGLSHIDTRKLVRHLRSAGVMRAGIFSGDQATG
CARA_BACCZ      ESIHPSVNGLIVNEICDHPSNFRNEISLNDYLKERKIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDDVEY
CARA_THETN      QSEKPHIRGFVVREYCDKPSNFQSEESLLSYLDNHNIPVLSGIDTRALTKKLRENGTMRGIITY--NPED
CARA_MYCTU      ESERIWVAGYAVRDPSPRASNWRATGTLEDELIRQRIVGIAGIDTRAVVRHLRSRGSMK----AGVFSDG
CARA_MYCBO      ESERIWVAGYAVRDPSPRASNWRATGTLEDELIRQRIVGIAGIDTRGVVRHLRSRGSMK----AGVFSDG
CARA_BIFLD      ESSRIWVAGYIVRDPSPNVSNWRAEGSLDDDLAKNGIVGLSHIDTRKLVRHLRSAGVMRAGIFSGDQATG
CARA_LACLM      ESIHPTCKAVVVHEAARRPSNWRMQMSFDEFLKSKNIPGITGVDTRAITKIVREHGTMKASLVARDEVDH
CARA_LACLA      ESIHPTCKAVVVHEAACRPSNWRMQMSFDEFLKAKNIPGITGVDTRAITKIVREHGTMKASLVARDEVEH
CARA_METM7      ESDGIKAEGFVVKDMTGL--------ELDEFLKEYNIPGISGVDTRYITRKIRSKGVIRSLLKTSTNPEE
CARA_METMP      ESDGIKAEGFVVKDI--------TGKELDEFLKEYNIPGISGVDTRYITRKIRSKGVIRSLLKTSTNPEE
CARA_DESMR      ESAHIRVAGFIVKECCKEPSNWRSTMTLPEYLTSQGITGIEGIDTRALTRHLRLHGAMRG-YISTDVSDP
CARA_METM5      ESDGIKAEGFVVKDM--------TGSKLDEFLKEYNIPGISGVDTRYITRKIRSKGVIRSLLKTSTNPEE
CARA_DESVV      ESGKVHVEAFIVKECCKVPSNWRSEISLPDYLKRHGVMGIEGIDTRALTRHLRIHGAMRG-VISTQETDP
CARA_DESVH      ESGKVHVEAFIVKECCKVPSNWRSEISLPDYLKRHGVMGIEGIDTRALTRHLRIHGAMRG-VISTQETDP
CARA_METM6      ESDGIKAEGFVVKDMTGLK--------LDEFLKEYNIPGISGVDTRYITRKIRSKGVIRSLLKTSTNPEE
CARA_METJA      ESDGIKAEGFVVREV--------TSKALDDFLKEYDIPGIQDIDTRFLTRKIRDKGVVKSCLVAEEISDD
CARA_MYCPA      ESDKIWVAGYAVRDPSPRVSNWRATGSLEDELIRQRIVGIARIDTRAVVRHLRTRGSMKAGVFSGDDPDE
CARA_CYACA      ESLKIQAKGIILKNLSNAYSNFRAMRSLLSFLKRHKVVEIHDIDTRALVLHIRNNKTML-AVISNETYNL
CARA_METAC      QSDNIHAEGLVVREACKKPYHYKSTRSIHQFLEDEGKPGIEGVDTRMLTIGARERGTMRAALITGSD-DG
CARA_METMA      QSDNIHAEGLVVREACKKPYHYKSTRSIHKFLEDEGKPGIEGVDTRMLTIGAREHGTMRAALITGSD-DG
CARA_DESDA      ESAGVHCAALLVKECCKKPSNWRSTMSLPEFMKRYEKPGVEGLDTRALTRHLRMNGAMRG-IISTRETDP
CARA_DESVM      ESGKVHVEAFIVKECCRTPSNWRAIMSLPDYLAQHGVMGIEGIDTRALTRHLRINGAMRG-IISTETDDR
CARA_CORGL      ESGKIWVAGLVIRDLAARVSNWRATTSLQQEMAGQGIVGIGGIDTRALVRHLRNEGSIAAGIFSGADAQR
CARA_MYCLE      ESDRIWVAGYAVRDPSPCASNWRATGTLEDELVRQRIVGIAGIDTRAVVRHLRRYGSMKAGVFSGKAMIE
CARA_METVS      ESEGIKAEGFIVKDMTGI--------ELDSFLKEYGVPGISDVDTRFITKKIRSKGVVKSLLKTSATXXX
CARA_HELAH      ESFFSSA-GILVRHYNEFFSNSRADFSLSAYLKERGVLGICGVDTRSLIKTLRHHGCLM-MVASTIEHDK
CARA_HELPJ      ESF-FSCAGVLARHYNEFFSNSRADSSLSTYLKKRGVLGISGVDTRSLIKTLRHHGCLM-MIASTIEHDR
CARA_METTH      QSDGIKAEGLIVREMCPAPSHSLSEKTLPEFLEEYGIPGIAGVDTRALTIKIRDKGTMKGALATEEIDDD
CARA_LAWIP      ESEKIHVSALIVKECCRNPSNWRSETSLPKFLQEYNIAGIEGIDTRALTRHIRINGAMRG-IISTSITDP
CARA_CHAGB      ESPHIQCAGVVVADVAEKYSHWTAVESLSEWCAREGVPVISGVDTRAIVTHLREQGSSLARISIGDEYDA
CARA_HELPY      ESF-FSCAGVLARHYNEFFSNSRADFSLSAYLKERGVLGVCGVDTRSLIKTLRHHGCLM-MVASTIEHDK
CARA_NEUCR      ESPHIQCAGIVVSDVATQYSHWTAVQSLGEWCASEGIPAISGVDTRAIVTYLREQGSSLARISIGDEYDA
CARA_CAMJE      ESKEIFASGVLMRELSSSFSNFRAKESLQDYLEKHGKIGIYELDTRYLVKMIRNNGNLRAVISTSNKEDL
CARA_ASPNC      ESPNLQAAGVVVADVAEQYSHWTAVESLGEWCAREGVPAISGVDTRAIVTYLREQGSSLARITVGEEYDA
CARA_DEBHA      ESPSVQCIGIVVADVALEYSHWTAVESLQQWCQRSGVAAISGVDTRQLVSYLREKGSSLAKITIGXXXXX
CARA_ASPOR      ESPHLQAAGVVVADVAEQYSHWTAVQSLGEWCAREGVPAISGVDTRAIVTYLREQGSSLARITVGEEYDA
CARA_SCHPO      ESPHIQCAGVVVNDYATKYSHWTAVESLGEWCAREGVAAITGVDTRAIVTFLREQGSSLAKISIGEEYDA
CARX_BACST      ESKRPHVEAVVVYEASREGFHYGAKYSLAEYLQHWNIPLLTHVDTRALVKEIRTAGTMM----------A
CARA_KLULA      ESPHIHVRGIVVAEYAWRYSHWTAVESLATWCQRENVTAIGGIDTRAVVQILREQGSSPSTIVQGSFIPK
CARA_CANAL      ESPKVQCIGIVVADAALEYSHWTAVESLQQWCKRSGVAAITGVDTRQLVSYLRDKGSSLGRITIGXXXXX
PYR1_HUMAN      ESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLGKLVQNGTEPS
CARA_TRIVE      ESPHIQCAGVVVSDVALNYSHWTAVESLSEWCAREASPPSPASDTRAIVTHLREQGSSLARISIGDEYDA
CARX_BACHD      ESKEPQAAGLIVSEQSEEGHHYEATQSLQQFCDQHQLPLLTGIDTRAVVKRIREQGDMPAVITTD-----
CARA_YEAST      ESPHIHVVGIVVAEYAYQYSHWTAVESLAQWCQREGVAAITGVDTRELVQYLREQGSSLGRITLADHDPV
CARA_YARLI      ESPHIQCIGIVVADAALKYSHWTAVESLGEWCKREGVAAISGVDTRAIVTYLREQGSSLGRITVGEEYDA
PYR1_SQUAC      ESAKIHAAALVIGENSQNPSHWSSVRSLDQRLKEHGIPALEGIDTRSLTKKIREKGTLLGKLVI-DGTD-
PYR1_MESAU      ESSENHVAGLVVGECCPTPSHWSATCTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLGKLVQSGTEPS
CARX_BACSU      ESKKPQVKAAVVYEACDHFSHYEAVYSLKEYLQKWNIPLLTHVDTRAVVKKIRANGTM-GATVTASKEGA
PYR1_EMENI      ESTEIHIAALVVATYAENYSHFLAESSLGQWLKEQGVPAIHGVDTRALTKRIRQKGSMLGRLLLHKETDA
PYR1_SCHPO      ESNQIHVAAIIISSYSQNYSHFLAHSSLGEWLKEQGIPGIFGIDTRALTKKIRDQGSMLGRLLIQKNPSS
CARA_PYRAE      ESDGIKAEGVVLFE-ATFPSHYKSVMSLEEWLASSGVPGVARVDTRALVQMLREHGVMMGAI---GPEDP
CARA_PHANO      ESPNIQASGIVVQDYALKHSHWTAVESLAQWCAREGVPAISGVDTREVVTYLREQGSSLARITVGXXXXX
CPSM_HUMAN      ESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQP--
CARX_LACPL      QAPTIGAQAIIVHELATFNDHYTSRQSLASFLTIHHVAGIEGVDTRDLTIHIRQTGAQMA--ILSNHP--
PYR1_DROME      DEGVVQATALVVGEVAEEAFHWRKWKTLPDWLKQHKVPGIQDIDTRALTKKLREQGSMLGKIVYEKPPVE
PYR1_DICDI      ESDKAHVQAIICSEYCDEYSHWAAEKSLSEWLKESNIPGLYGIDTRALITKIREKGSLKGKVIIGDFDES
CPSM_MOUSE      ESDGIKVAGLLVLNYSNDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIFEGQSVD-
CARA_CANGA      ESSHIQVAGIVVADYAAQYSHWTAVESLGDWCKREGVAAITGVDTREIVQYLREQGSSQSRILVSDTPK-
CPSM_RAT        ESDGIKVAGLLVLNYSHDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIFEGQSVD-
CARA_NEOFI      ESPNLQAAGVVVADVAEQYSHWTAVESLGEWCAREGVPAISGVDTRAIVTYLREQGSSLARITVGEEYDA
CARA_ASPFU      ESPNLQAAGVVVADVAEQYSHWTAVESLGEWCAREGVPAISGVDTRAIVTYLRERGSSLARITVGEEYDA
PYR1_YEAST      ESNRIHIAGLVISHYTDEYSHYLRKSSLGKWLQNEGIPAVYGVDTRSLTKHLRDAGSMLG----------
CARA_COCIM      ESPSLQAVGVVVADVAEKYSHWTAVESLSEWCIREGVPAISGVDTRAIVTYLREQGSSLAKISVGEEYDA
CARA_ASPCL      ESPHLQAAGVVVADVAEQYSHWTAVESLGEWCAREGVPAISGVDTRAIVTYLREQGSSLARITVGEEYDA
CPSM_RANCA      ESENIQASGLLVLDYSHEYSHWGAVKSLSEWLHEEKVPALCGIDTRMLAKKIRDKGAVLGKIEFEGQPVE
CARA_ASHGO      ESSKVHVSAIVVAEYAWEYSHWTAVQSLGDWCRKEGVAAIGGIDTRAVVQYLRESGSTMGRVDVEGAAAS
CARA_HALSA      ESDRVHPSAVVAREL---------TDDVADWLRTEGVPAVDGIDTRDLVLDIRDGGAMQVGIAAGPDASP
CARA_HALS3      ESDRVHPSAVVAREL---------TDDVADWLRTEGVPAVDGIDTRDLVLDIRDGGAMQVGIAAGPDASP
CARA_SULSO      ESERIQVEGLIVAE-HTYPSKWNSALTLDEWLKSENVPGVFDVDTRMIVKKIRTYGTMMG-IIASE----
CARA_SULAC      ESERIQAEGLVISELTE-PFKWNSKQTLHEWLLSEGIPGVYGIDTRAVVKRVRSRGVMMGIIASGNNPEE
CARA_METS5      ESEQIQIEGLVVTE-ETDPSKWNSSKSLHQWMAEQGIPGVSSVDTRLLVKKVRTLGSMMGVIASGEHVED
CARA_PYRFU      ESDSIKVEGFVISFL-MRPNHWSSEMTLDEWLRREGVPGLYGVDTRALVKKIREEGVMRGAIVTTET-DL
CARA_EMENI      ESPNLQAAGVVVADVAEQYSHWTAVQSLGEWCAREGVPAISGVDTRAIVTYLREQGSSLARITVGEEYDA
CARA_SULTO      ESEQIQVEGLVVSE-ETDPFKWNSSKSLHEWLLSEGVPGLSDVDTRSIVKKVRSRGVMMGVIASG-----
CARA_THEVO      ESNGVKVSALITKDAHIELKKGGYGREFDEFLKEQGIPGIDGIDTRMLVRKIRANGVLRSYVV--NDPSH
CARA_THEAC      ESDRVKVSGIVTRDAHINMPAGTLGLDFDRFLRDEGIPAIDGVDTRLLVRKIRQGGVLRAYI--ADDP--
TRPG_THEMA      ----------------------------------------------------------------------
TRPG_PYRKO      ----------------------------------------------------------------------
TRPG_METJA      ----------------------------------------------------------------------
TRPE_RHIME      ----------------------------------------------------------------------
TRPG_AZOBR      ----------------------------------------------------------------------
TRPG2_HALMA     ----------------------------------------------------------------------
PABA_BACSU      ----------------------------------------------------------------------
GUAAA_METBF     ----------------------------------------------------------------------
TRPG_PORPU      ----------------------------------------------------------------------
GUAAA_UNCMA     ----------------------------------------------------------------------
GUAAA_METST     ----------------------------------------------------------------------
GUAAA_METBU     ----------------------------------------------------------------------
TRPG_PORYE      ----------------------------------------------------------------------
TRPG_LACLA      ----------------------------------------------------------------------
GUAA_FUSNN      ----------------------------------------------------------------------
PABA_KLEAE      ----------------------------------------------------------------------
TRPG_ACIAD      ----------------------------------------------------------------------
GUAA_BIFLO      ----------------------------------------------------------------------
PABS_STRGR      ----------------------------------------------------------------------
GUAA_ALKMQ      ----------------------------------------------------------------------
TRPG_SULSO      ----------------------------------------------------------------------
TRPG_CYAPA      ----------------------------------------------------------------------
GUAA_LACAC      ----------------------------------------------------------------------
TRPG_YEAST      ----------------------------------------------------------------------
GUAA_LACRJ      ----------------------------------------------------------------------
GUAA_LACRD      ----------------------------------------------------------------------
GUAA_LACGA      ----------------------------------------------------------------------
GUAA_CLOK5      ----------------------------------------------------------------------
GUAA_CLOK1      ----------------------------------------------------------------------
TRPG_PSEPU      ----------------------------------------------------------------------
PABA_SALTY      ----------------------------------------------------------------------
GUAA_RUTMC      ----------------------------------------------------------------------
GUAA_BACC2      ----------------------------------------------------------------------
GUAA_THICR      ----------------------------------------------------------------------
GUAA_LISMO      ----------------------------------------------------------------------
GUAAA_METAC     ----------------------------------------------------------------------
TRPG_LEPBI      ----------------------------------------------------------------------
GUAA_LISMF      ----------------------------------------------------------------------
GUAA_BACCN      ----------------------------------------------------------------------
GUAA_WOLWR      ----------------------------------------------------------------------
GUAA_WOLPM      ----------------------------------------------------------------------
GUAA_OCEIH      ----------------------------------------------------------------------
GUAA_CALS8      ----------------------------------------------------------------------
GUAA_BACSU      ----------------------------------------------------------------------
GUAA_BACCR      ----------------------------------------------------------------------
TRPG_PSEAE      ----------------------------------------------------------------------
TRPG_PENCH      ----------------------------------------------------------------------
PABA_SERMA      ----------------------------------------------------------------------
GUAA_STRZP      ----------------------------------------------------------------------
GUAA_CORAM      ----------------------------------------------------------------------
GUAA_BACLD      ----------------------------------------------------------------------
GUAA_BACC4      ----------------------------------------------------------------------
GUAA_STRMU      ----------------------------------------------------------------------
GUAA_LISIN      ----------------------------------------------------------------------
GUAAA_PYRAB     ----------------------------------------------------------------------
GUAA_ANATD      ----------------------------------------------------------------------
GUAA_SULNB      ----------------------------------------------------------------------
GUAA_LACJO      ----------------------------------------------------------------------
GUAA_CORGL      ----------------------------------------------------------------------
GUAA_CORGB      ----------------------------------------------------------------------
GUAA_CLONN      ----------------------------------------------------------------------
GUAA_CLOBA      ----------------------------------------------------------------------
GUAA_BACWK      ----------------------------------------------------------------------
GUAA_BACA2      ----------------------------------------------------------------------
GUAA_TROWT      ----------------------------------------------------------------------
GUAA_STRZT      ----------------------------------------------------------------------
GUAA_STRZJ      ----------------------------------------------------------------------
GUAA_STRR6      ----------------------------------------------------------------------
GUAA_STRPS      ----------------------------------------------------------------------
GUAA_STRPN      ----------------------------------------------------------------------
GUAA_STRPJ      ----------------------------------------------------------------------
GUAA_STRPI      ----------------------------------------------------------------------
GUAA_STRP7      ----------------------------------------------------------------------
GUAA_STRP4      ----------------------------------------------------------------------
GUAA_STRP2      ----------------------------------------------------------------------
GUAA_LEGPL      ----------------------------------------------------------------------
GUAA_LEGPA      ----------------------------------------------------------------------
GUAA_DEIGD      ----------------------------------------------------------------------
GUAA_BACC1      ----------------------------------------------------------------------
TRPG_HAEIN      ----------------------------------------------------------------------
GUAA_THEFY      ----------------------------------------------------------------------
GUAA_SULDN      ----------------------------------------------------------------------
GUAA_NITSB      ----------------------------------------------------------------------
GUAAA_PYRHO     ----------------------------------------------------------------------
GUAAA_METMA     ----------------------------------------------------------------------
GUAA_LEGPC      ----------------------------------------------------------------------
GUAA_LACDB      ----------------------------------------------------------------------
GUAA_LACDA      ----------------------------------------------------------------------
GUAA_JANMA      ----------------------------------------------------------------------
GUAA_XYLFT      ----------------------------------------------------------------------
GUAA_XYLFM      ----------------------------------------------------------------------
GUAA_XYLF2      ----------------------------------------------------------------------
GUAA_STRA5      ----------------------------------------------------------------------
GUAA_STRA3      ----------------------------------------------------------------------
GUAA_STRA1      ----------------------------------------------------------------------
GUAA_RHIEC      ----------------------------------------------------------------------
GUAA_ELUMP      ----------------------------------------------------------------------
GUAA_CLOBB      ----------------------------------------------------------------------
GUAA_BORGA      ----------------------------------------------------------------------
GUAA_BACHK      ----------------------------------------------------------------------
GUAA_BACCZ      ----------------------------------------------------------------------
GUAA_BACC3      ----------------------------------------------------------------------
GUAA_BACC0      ----------------------------------------------------------------------
GUAA_BACAN      ----------------------------------------------------------------------
GUAA_BACAH      ----------------------------------------------------------------------
GUAA_BACAC      ----------------------------------------------------------------------
GUAA_BACAA      ----------------------------------------------------------------------
GUAAA_PYRKO     ----------------------------------------------------------------------
PABA_ECOLI      ----------------------------------------------------------------------
GUAA_TROW8      ----------------------------------------------------------------------
GUAA_RHIE6      ----------------------------------------------------------------------
GUAA_CLOTE      ----------------------------------------------------------------------
TRPG_PHYBL      ----------------------------------------------------------------------
GUAA_STAAW      ----------------------------------------------------------------------
GUAA_STAAT      ----------------------------------------------------------------------
GUAA_STAAS      ----------------------------------------------------------------------
GUAA_STAAR      ----------------------------------------------------------------------
GUAA_STAAN      ----------------------------------------------------------------------
GUAA_STAAM      ----------------------------------------------------------------------
GUAA_STAAE      ----------------------------------------------------------------------
GUAA_STAAC      ----------------------------------------------------------------------
GUAA_STAA9      ----------------------------------------------------------------------
GUAA_STAA8      ----------------------------------------------------------------------
GUAA_STAA3      ----------------------------------------------------------------------
GUAA_STAA2      ----------------------------------------------------------------------
GUAA_STAA1      ----------------------------------------------------------------------
GUAA_RHOBA      ----------------------------------------------------------------------
GUAA_EUBE2      ----------------------------------------------------------------------
GUAA_ARCB4      ----------------------------------------------------------------------
GUAAA_METTP     ----------------------------------------------------------------------
TRPG_ARCFU      ----------------------------------------------------------------------
GUAA_THETN      ----------------------------------------------------------------------
GUAA_THEAB      ----------------------------------------------------------------------
GUAA_RHISN      ----------------------------------------------------------------------
GUAA_RHILW      ----------------------------------------------------------------------
GUAA_MICLC      ----------------------------------------------------------------------
GUAA_HERAR      ----------------------------------------------------------------------
GUAA_CHLT3      ----------------------------------------------------------------------
TRPE_AZOBR      ----------------------------------------------------------------------
GUAA_STRPG      ----------------------------------------------------------------------
GUAA_PROM5      ----------------------------------------------------------------------
GUAA_LISW6      ----------------------------------------------------------------------
GUAA_DEIDV      ----------------------------------------------------------------------
GUAA_COXBU      ----------------------------------------------------------------------
GUAA_COXBR      ----------------------------------------------------------------------
GUAA_COXB2      ----------------------------------------------------------------------
GUAA_COXB1      ----------------------------------------------------------------------
GUAA_COREF      ----------------------------------------------------------------------
TRPG_NEUCR      ----------------------------------------------------------------------
TRPG_METTH      ----------------------------------------------------------------------
GUAA_XYLFA      ----------------------------------------------------------------------
GUAA_WOLSU      ----------------------------------------------------------------------
GUAA_STRU0      ----------------------------------------------------------------------
GUAA_STRT2      ----------------------------------------------------------------------
GUAA_STRT1      ----------------------------------------------------------------------
GUAA_STAES      ----------------------------------------------------------------------
GUAA_STAEQ      ----------------------------------------------------------------------
GUAA_GEOKA      ----------------------------------------------------------------------
GUAA_CORDI      ----------------------------------------------------------------------
GUAA_CARHZ      ----------------------------------------------------------------------
GUAAA_HALSA     ----------------------------------------------------------------------
TRPG_ASPNG      ----------------------------------------------------------------------
GUAA_THEM4      ----------------------------------------------------------------------
GUAA_STACT      ----------------------------------------------------------------------
GUAA_RHOPA      ----------------------------------------------------------------------
GUAA_HELAH      ----------------------------------------------------------------------
GUAA_CORJK      ----------------------------------------------------------------------
GUAA_CLOCE      ----------------------------------------------------------------------
GUAA_CAMFF      ----------------------------------------------------------------------
GUAA_BACP2      ----------------------------------------------------------------------
GUAA_AGRVS      ----------------------------------------------------------------------
TRPG_METTM      ----------------------------------------------------------------------
GUAA_STRPZ      ----------------------------------------------------------------------
GUAA_STRPM      ----------------------------------------------------------------------
GUAA_STRPF      ----------------------------------------------------------------------
GUAA_STRPD      ----------------------------------------------------------------------
GUAA_STRPC      ----------------------------------------------------------------------
GUAA_STRPB      ----------------------------------------------------------------------
GUAA_STRP8      ----------------------------------------------------------------------
GUAA_STRP6      ----------------------------------------------------------------------
GUAA_STRP1      ----------------------------------------------------------------------
GUAA_STRAW      ----------------------------------------------------------------------
GUAA_STAS1      ----------------------------------------------------------------------
GUAA_RHOP2      ----------------------------------------------------------------------
GUAA_PROMP      ----------------------------------------------------------------------
GUAA_NOSP7      ----------------------------------------------------------------------
GUAA_LEGPH      ----------------------------------------------------------------------
TRPG_THET8      ----------------------------------------------------------------------
GUAA_STRP3      ----------------------------------------------------------------------
GUAA_NITHX      ----------------------------------------------------------------------
GUAA_AGRRK      ----------------------------------------------------------------------
GUAAA_PICTO     ----------------------------------------------------------------------
TRPG_EMENI      ----------------------------------------------------------------------
PABS_SCHPO      ----------------------------------------------------------------------
GUAA_WOLPP      ----------------------------------------------------------------------
GUAA_STAAB      ----------------------------------------------------------------------
GUAA_LACLS      ----------------------------------------------------------------------
GUAA_LACLM      ----------------------------------------------------------------------
GUAA_CAMHC      ----------------------------------------------------------------------
GUAAA_HALWD     ----------------------------------------------------------------------
GUAA_WOLTR      ----------------------------------------------------------------------
GUAA_THEEB      ----------------------------------------------------------------------
GUAA_PROM0      ----------------------------------------------------------------------
GUAA_COXBN      ----------------------------------------------------------------------
GUAA_CLOPE      ----------------------------------------------------------------------
GUAA_CLOB8      ----------------------------------------------------------------------
GUAA_ANAVT      ----------------------------------------------------------------------
TRPG1_HALMA     ----------------------------------------------------------------------
GUAA_STAHJ      ----------------------------------------------------------------------
GUAA_SALRD      ----------------------------------------------------------------------
GUAA_RHIME      ----------------------------------------------------------------------
GUAA_PROMS      ----------------------------------------------------------------------
GUAA_MACCJ      ----------------------------------------------------------------------
GUAA_HELPS      ----------------------------------------------------------------------
GUAA_EUBR3      ----------------------------------------------------------------------
GUAA_ENTFA      ----------------------------------------------------------------------
GUAA_DESAD      ----------------------------------------------------------------------
GUAA_CYAP7      ----------------------------------------------------------------------
GUAA_BACHD      ----------------------------------------------------------------------
GUAAA_THEVO     ----------------------------------------------------------------------
GUAAA_PYRFU     ----------------------------------------------------------------------
GUAAA_ARCFU     ----------------------------------------------------------------------
GUAA_RHIL3      ----------------------------------------------------------------------
GUAA_CHLPB      ----------------------------------------------------------------------
GUAA_BARQU      ----------------------------------------------------------------------
GUAA_BACSK      ----------------------------------------------------------------------
TRPG_CORGL      ----------------------------------------------------------------------
GUAA_SINMW      ----------------------------------------------------------------------
GUAA_PROMT      ----------------------------------------------------------------------
GUAA_PEDPA      ----------------------------------------------------------------------
GUAA_HELPY      ----------------------------------------------------------------------
GUAA_DEIRA      ----------------------------------------------------------------------
GUAA_CLOBL      ----------------------------------------------------------------------
GUAA_CLOBK      ----------------------------------------------------------------------
GUAA_CLOBJ      ----------------------------------------------------------------------
GUAA_CLOBH      ----------------------------------------------------------------------
GUAA_CLOB6      ----------------------------------------------------------------------
GUAA_CLOB1      ----------------------------------------------------------------------
GUAA_CAMLR      ----------------------------------------------------------------------
GUAAA_METTH     ----------------------------------------------------------------------
GUAA_PROM1      ----------------------------------------------------------------------
GUAA_LACLA      ----------------------------------------------------------------------
GUAA_ZYMMO      ----------------------------------------------------------------------
GUAA_STRS7      ----------------------------------------------------------------------
GUAA_STRE4      ----------------------------------------------------------------------
GUAA_HELPJ      ----------------------------------------------------------------------
GUAA_HELPH      ----------------------------------------------------------------------
GUAA_HELHP      ----------------------------------------------------------------------
GUAA_DESVM      ----------------------------------------------------------------------
GUAA_CYAA5      ----------------------------------------------------------------------
GUAA_CLOBM      ----------------------------------------------------------------------
GUAA_CAMJE      ----------------------------------------------------------------------
GUAA_ANASP      ----------------------------------------------------------------------
GUAA_STRCO      ----------------------------------------------------------------------
GUAA_LACS1      ----------------------------------------------------------------------
GUAA_DEHSC      ----------------------------------------------------------------------
GUAA_CAMJR      ----------------------------------------------------------------------
GUAA_BORBU      ----------------------------------------------------------------------
GUAA_BDEBA      ----------------------------------------------------------------------
GUAA_ASPFU      ----------------------------------------------------------------------
GUAA_ALCBS      ----------------------------------------------------------------------
TRPG_PICAN      ----------------------------------------------------------------------
TRPG_CLOTM      ----------------------------------------------------------------------
GUAA_LEIXX      ----------------------------------------------------------------------
GUAA_CLOD6      ----------------------------------------------------------------------
GUAA_CAMJJ      ----------------------------------------------------------------------
GUAA_CAMJD      ----------------------------------------------------------------------
TRPG_VIBPA      ----------------------------------------------------------------------
GUAA_VIBSL      ----------------------------------------------------------------------
GUAA_PROM9      ----------------------------------------------------------------------
GUAA_MYCPE      ----------------------------------------------------------------------
GUAA_MOOTA      ----------------------------------------------------------------------
GUAA_LACSS      ----------------------------------------------------------------------
GUAA_CAMJ8      ----------------------------------------------------------------------
GUAA_ASHGO      ----------------------------------------------------------------------
GUAA_AGRT5      ----------------------------------------------------------------------
GUAAA_METJA     ----------------------------------------------------------------------
TRPG_ECOLI      ----------------------------------------------------------------------
TRPG_ASPAW      ----------------------------------------------------------------------
GUAA_SYNWW      ----------------------------------------------------------------------
GUAA_RHILO      ----------------------------------------------------------------------
GUAA_PROMA      ----------------------------------------------------------------------
GUAA_PHOPR      ----------------------------------------------------------------------
GUAA_NITMU      ----------------------------------------------------------------------
GUAA_HELPG      ----------------------------------------------------------------------
GUAA_AQUAE      ----------------------------------------------------------------------
TRPG_SHIDY      ----------------------------------------------------------------------
GUAA_VIBFM      ----------------------------------------------------------------------
GUAA_VIBF1      ----------------------------------------------------------------------
GUAA_SYNY3      ----------------------------------------------------------------------
GUAA_MYCLE      ----------------------------------------------------------------------
GUAA_MYCLB      ----------------------------------------------------------------------
GUAA_LACPL      ----------------------------------------------------------------------
GUAA_HELP2      ----------------------------------------------------------------------
GUAA_DESVV      ----------------------------------------------------------------------
GUAA_DESVH      ----------------------------------------------------------------------
GUAA_DESPS      ----------------------------------------------------------------------
GUAA_ALISL      ----------------------------------------------------------------------
GUAA_VIBHB      ----------------------------------------------------------------------
GUAA_THERP      ----------------------------------------------------------------------
GUAA_PROM2      ----------------------------------------------------------------------
GUAA_HALOH      ----------------------------------------------------------------------
GUAA_DESDG      ----------------------------------------------------------------------
GUAA_DEHE1      ----------------------------------------------------------------------
GUAA_CLOTH      ----------------------------------------------------------------------
GUAA_BRASO      ----------------------------------------------------------------------
GUAAA_METM7     ----------------------------------------------------------------------
GUAA_SYNPX      ----------------------------------------------------------------------
GUAA_AERHH      ----------------------------------------------------------------------
GUAAA_METVS     ----------------------------------------------------------------------
TRPG_CYACA      ----------------------------------------------------------------------
GUAA_SYNSC      ----------------------------------------------------------------------
GUAA_SYNS9      ----------------------------------------------------------------------
GUAA_RALEJ      ----------------------------------------------------------------------
GUAA_NOCFA      ----------------------------------------------------------------------
GUAA_CAEEL      ----------------------------------------------------------------------
GUAA_BARHE      ----------------------------------------------------------------------
GUAA_ACIAD      ----------------------------------------------------------------------
GUAA_VIBVY      ----------------------------------------------------------------------
GUAA_VIBVU      ----------------------------------------------------------------------
GUAA_VIBCM      ----------------------------------------------------------------------
GUAA_VIBCH      ----------------------------------------------------------------------
GUAA_VIBC3      ----------------------------------------------------------------------
GUAA_PELPB      ----------------------------------------------------------------------
GUAA_OLICO      ----------------------------------------------------------------------
GUAA_HAHCH      ----------------------------------------------------------------------
GUAA_FINM2      ----------------------------------------------------------------------
GUAA_AERS4      ----------------------------------------------------------------------
TRPG_YERPE      ----------------------------------------------------------------------
PYRG_PSEF5      ----------------------------------------------------------------------
GUAA_TOLAT      ----------------------------------------------------------------------
GUAA_SPIKU      ----------------------------------------------------------------------
GUAA_PSEA6      ----------------------------------------------------------------------
GUAA_NITWN      ----------------------------------------------------------------------
GUAA_NATTJ      ----------------------------------------------------------------------
GUAA_CHLCV      ----------------------------------------------------------------------
TRPG_SALTY      ----------------------------------------------------------------------
TRPG_HALVO      ----------------------------------------------------------------------
GUAA_VESOH      ----------------------------------------------------------------------
GUAA_PSEAE      ----------------------------------------------------------------------
GUAA_PSEAB      ----------------------------------------------------------------------
GUAA_PSEA8      ----------------------------------------------------------------------
GUAA_MYCMM      ----------------------------------------------------------------------
GUAA_LACRH      ----------------------------------------------------------------------
GUAA_LACCB      ----------------------------------------------------------------------
GUAA_LACC3      ----------------------------------------------------------------------
GUAA_ENT38      ----------------------------------------------------------------------
GUAA_CHLMU      ----------------------------------------------------------------------
GUAAA_THEAC     ----------------------------------------------------------------------
PYRG_PSEPF      ----------------------------------------------------------------------
GUAA_VIBPA      ----------------------------------------------------------------------
GUAA_THIDA      ----------------------------------------------------------------------
GUAA_THET8      ----------------------------------------------------------------------
GUAA_THET2      ----------------------------------------------------------------------
GUAA_SALTY      ----------------------------------------------------------------------
GUAA_CHLFF      ----------------------------------------------------------------------
GUAA_BLOPB      ----------------------------------------------------------------------
GUAA_TREDE      ----------------------------------------------------------------------
GUAA_BURP8      ----------------------------------------------------------------------
GUAA_XANOR      ----------------------------------------------------------------------
GUAA_XANOP      ----------------------------------------------------------------------
GUAA_XANOM      ----------------------------------------------------------------------
GUAA_XANCP      ----------------------------------------------------------------------
GUAA_XANCB      ----------------------------------------------------------------------
GUAA_XANC8      ----------------------------------------------------------------------
GUAA_XANC5      ----------------------------------------------------------------------
GUAA_XANAC      ----------------------------------------------------------------------
GUAA_STRMK      ----------------------------------------------------------------------
GUAA_STRM5      ----------------------------------------------------------------------
GUAA_PROVI      ----------------------------------------------------------------------
GUAA_PROM3      ----------------------------------------------------------------------
GUAA_PROAC      ----------------------------------------------------------------------
GUAA_PHOLL      ----------------------------------------------------------------------
GUAA_PHEZH      ----------------------------------------------------------------------
GUAA_PELPD      ----------------------------------------------------------------------
GUAA_ALTMD      ----------------------------------------------------------------------
GUAAA_METMP     ----------------------------------------------------------------------
GUAA_YERPY      ----------------------------------------------------------------------
GUAA_YERPS      ----------------------------------------------------------------------
GUAA_YERPP      ----------------------------------------------------------------------
GUAA_YERPN      ----------------------------------------------------------------------
GUAA_YERPG      ----------------------------------------------------------------------
GUAA_YERPE      ----------------------------------------------------------------------
GUAA_YERPB      ----------------------------------------------------------------------
GUAA_YERPA      ----------------------------------------------------------------------
GUAA_YERP3      ----------------------------------------------------------------------
GUAA_YERE8      ----------------------------------------------------------------------
GUAA_SALAR      ----------------------------------------------------------------------
GUAA_KLEP7      ----------------------------------------------------------------------
GUAA_KLEP3      ----------------------------------------------------------------------
GUAA_GIBZE      ----------------------------------------------------------------------
GUAA_FRATW      ----------------------------------------------------------------------
GUAA_CLOAB      ----------------------------------------------------------------------
GUAA_CHLL2      ----------------------------------------------------------------------
GUAAA_METM6     ----------------------------------------------------------------------
GUAA_SERP5      ----------------------------------------------------------------------
GUAA_RALME      ----------------------------------------------------------------------
GUAA_PSEHT      ----------------------------------------------------------------------
GUAA_PASMU      ----------------------------------------------------------------------
GUAA_IDILO      ----------------------------------------------------------------------
GUAA_FRATT      ----------------------------------------------------------------------
GUAA_FRAT1      ----------------------------------------------------------------------
GUAA_EXIS2      ----------------------------------------------------------------------
GUAA_ESCF3      ----------------------------------------------------------------------
GUAA_ECO27      ----------------------------------------------------------------------
GUAA_BRAHW      ----------------------------------------------------------------------
GUAA_BLOFL      ----------------------------------------------------------------------
GUAAA_METM5     ----------------------------------------------------------------------
Y1171_HAEIN     ----------------------------------------------------------------------
TRPG_SERMA      ----------------------------------------------------------------------
GUAA_SHISS      ----------------------------------------------------------------------
GUAA_SHIDS      ----------------------------------------------------------------------
GUAA_SHIBS      ----------------------------------------------------------------------
GUAA_SHIB3      ----------------------------------------------------------------------
GUAA_SALTI      ----------------------------------------------------------------------
GUAA_SALSV      ----------------------------------------------------------------------
GUAA_SALPK      ----------------------------------------------------------------------
GUAA_SALPC      ----------------------------------------------------------------------
GUAA_SALPB      ----------------------------------------------------------------------
GUAA_SALPA      ----------------------------------------------------------------------
GUAA_SALNS      ----------------------------------------------------------------------
GUAA_SALHS      ----------------------------------------------------------------------
GUAA_SALG2      ----------------------------------------------------------------------
GUAA_SALEP      ----------------------------------------------------------------------
GUAA_SALDC      ----------------------------------------------------------------------
GUAA_SALCH      ----------------------------------------------------------------------
GUAA_SALA4      ----------------------------------------------------------------------
GUAA_PSEPK      ----------------------------------------------------------------------
GUAA_PSEPG      ----------------------------------------------------------------------
GUAA_PSEP1      ----------------------------------------------------------------------
GUAA_PSEMY      ----------------------------------------------------------------------
GUAA_PHANO      ----------------------------------------------------------------------
GUAA_NEIG2      ----------------------------------------------------------------------
GUAA_HAMD5      ----------------------------------------------------------------------
GUAA_HAES2      ----------------------------------------------------------------------
GUAA_GLOVI      ----------------------------------------------------------------------
GUAA_ECOUT      ----------------------------------------------------------------------
GUAA_ECOSM      ----------------------------------------------------------------------
GUAA_ECOSE      ----------------------------------------------------------------------
GUAA_ECOLU      ----------------------------------------------------------------------
GUAA_ECOLI      ----------------------------------------------------------------------
GUAA_ECOLC      ----------------------------------------------------------------------
GUAA_ECOL6      ----------------------------------------------------------------------
GUAA_ECOL5      ----------------------------------------------------------------------
GUAA_ECOK1      ----------------------------------------------------------------------
GUAA_ECOHS      ----------------------------------------------------------------------
GUAA_ECODH      ----------------------------------------------------------------------
GUAA_ECOBW      ----------------------------------------------------------------------
GUAA_ECO8A      ----------------------------------------------------------------------
GUAA_ECO81      ----------------------------------------------------------------------
GUAA_ECO7I      ----------------------------------------------------------------------
GUAA_ECO5E      ----------------------------------------------------------------------
GUAA_ECO57      ----------------------------------------------------------------------
GUAA_ECO55      ----------------------------------------------------------------------
GUAA_ECO45      ----------------------------------------------------------------------
GUAA_ECO24      ----------------------------------------------------------------------
GUAA_CHRVO      ----------------------------------------------------------------------
GUAA_CHLTE      ----------------------------------------------------------------------
GUAA_BRUSU      ----------------------------------------------------------------------
GUAA_BRUSI      ----------------------------------------------------------------------
GUAA_BRUO2      ----------------------------------------------------------------------
GUAA_BRUME      ----------------------------------------------------------------------
GUAA_BRUMB      ----------------------------------------------------------------------
GUAA_BRUC2      ----------------------------------------------------------------------
GUAA_BRUAB      ----------------------------------------------------------------------
GUAA_BRUA2      ----------------------------------------------------------------------
GUAA_BRUA1      ----------------------------------------------------------------------
GUAA_BRAJA      ----------------------------------------------------------------------
GUAA_BARBK      ----------------------------------------------------------------------
GUAA_ANAMM      ----------------------------------------------------------------------
GUAA_ANAMF      ----------------------------------------------------------------------
GUAAA_METS3     ----------------------------------------------------------------------
GUAAA_METKA     ----------------------------------------------------------------------
TRPG_SCHPO      ----------------------------------------------------------------------
PYRG_PSESM      ----------------------------------------------------------------------
PYRG_PSE14      ----------------------------------------------------------------------
PYRG_LACJO      ----------------------------------------------------------------------
GUAA_SHIFL      ----------------------------------------------------------------------
GUAA_SHIF8      ----------------------------------------------------------------------
GUAA_PSYIN      ----------------------------------------------------------------------
GUAA_MYCTU      ----------------------------------------------------------------------
GUAA_MYCTA      ----------------------------------------------------------------------
GUAA_MYCBT      ----------------------------------------------------------------------
GUAA_MYCBP      ----------------------------------------------------------------------
GUAA_MYCBO      ----------------------------------------------------------------------
GUAA_GEOSL      ----------------------------------------------------------------------
GUAA_CITK8      ----------------------------------------------------------------------
GUAAA_HALMA     ----------------------------------------------------------------------
PYRG_RICFE      ----------------------------------------------------------------------
PYRG_PSEFS      ----------------------------------------------------------------------
GUAA_SODGM      ----------------------------------------------------------------------
GUAA_RALEH      ----------------------------------------------------------------------
GUAA_PSEE4      ----------------------------------------------------------------------
GUAA_PROMM      ----------------------------------------------------------------------
GUAA_PROMH      ----------------------------------------------------------------------
GUAA_NITEC      ----------------------------------------------------------------------
GUAA_MANSM      ----------------------------------------------------------------------
GUAA_HELMI      ----------------------------------------------------------------------
GUAA_HAES1      ----------------------------------------------------------------------
GUAA_GEOSF      ----------------------------------------------------------------------
GUAA_CANGA      ----------------------------------------------------------------------
GUAA_ACTSZ      ----------------------------------------------------------------------
GUAAA_NATPD     ----------------------------------------------------------------------
PYRG_TOLAT      ----------------------------------------------------------------------
PYRG_ENTFA      ----------------------------------------------------------------------
GUAA_POLSQ      ----------------------------------------------------------------------
GUAA_POLNS      ----------------------------------------------------------------------
GUAA_NITOC      ----------------------------------------------------------------------
GUAA_HAEPS      ----------------------------------------------------------------------
GUAA_GEOMG      ----------------------------------------------------------------------
GUAA_FRATO      ----------------------------------------------------------------------
GUAA_FRATN      ----------------------------------------------------------------------
GUAA_FRATH      ----------------------------------------------------------------------
GUAA_FRATF      ----------------------------------------------------------------------
GUAA_BURCJ      ----------------------------------------------------------------------
GUAA_ACTPJ      ----------------------------------------------------------------------
GUAA_ACTP7      ----------------------------------------------------------------------
GUAA_ACTP2      ----------------------------------------------------------------------
PYRG_PSEU2      ----------------------------------------------------------------------
PYRG_OCEIH      ----------------------------------------------------------------------
GUAA_TERTT      ----------------------------------------------------------------------
GUAA_SHELP      ----------------------------------------------------------------------
GUAA_RHORT      ----------------------------------------------------------------------
GUAA_PSEU2      ----------------------------------------------------------------------
GUAA_PSEPW      ----------------------------------------------------------------------
GUAA_PELCD      ----------------------------------------------------------------------
GUAA_NITEU      ----------------------------------------------------------------------
GUAA_METCA      ----------------------------------------------------------------------
GUAA_GLUOX      ----------------------------------------------------------------------
GUAA_FRASN      ----------------------------------------------------------------------
GUAA_AERPE      ----------------------------------------------------------------------
TRPG_PHACH      ----------------------------------------------------------------------
GUAA_USTMA      ----------------------------------------------------------------------
GUAA_SHEPW      ----------------------------------------------------------------------
GUAA_SHEDO      ----------------------------------------------------------------------
GUAA_NEIG1      ----------------------------------------------------------------------
GUAA_METFK      ----------------------------------------------------------------------
GUAA_EDWI9      ----------------------------------------------------------------------
GUAA_CHLPD      ----------------------------------------------------------------------
GUAA_CELJU      ----------------------------------------------------------------------
GUAA_AZOSB      ----------------------------------------------------------------------
TRPG_VIBCH      ----------------------------------------------------------------------
PYRG_LACPL      ----------------------------------------------------------------------
PYRG_AZOVD      ----------------------------------------------------------------------
PHZE_PSEFL      ----------------------------------------------------------------------
GUAA_SYMTH      ----------------------------------------------------------------------
GUAA_SHEPA      ----------------------------------------------------------------------
GUAA_SHEHH      ----------------------------------------------------------------------
GUAA_RALPJ      ----------------------------------------------------------------------
GUAA_PELLD      ----------------------------------------------------------------------
GUAA_HAEDU      ----------------------------------------------------------------------
GUAA_FRATM      ----------------------------------------------------------------------
GUAA_DECAR      ----------------------------------------------------------------------
GUAA_CUPTR      ----------------------------------------------------------------------
GUAA_BURXL      ----------------------------------------------------------------------
GUAA_BURPP      ----------------------------------------------------------------------
GUAAA_SULSO     ----------------------------------------------------------------------
PYRG_CHLTR      ----------------------------------------------------------------------
PYRG_CHLTB      ----------------------------------------------------------------------
PYRG_CHLTA      ----------------------------------------------------------------------
PYRG_CHLT2      ----------------------------------------------------------------------
GUAA_SHEWM      ----------------------------------------------------------------------
GUAA_PETMO      ----------------------------------------------------------------------
GUAA_MYCPA      ----------------------------------------------------------------------
GUAA_CHLCH      ----------------------------------------------------------------------
GUAA_BURM1      ----------------------------------------------------------------------
GUAA_BURCM      ----------------------------------------------------------------------
GUAA_BURA4      ----------------------------------------------------------------------
TRPG_HALSA      ----------------------------------------------------------------------
TRPG_BUCAP      ----------------------------------------------------------------------
PYRG_THICR      ----------------------------------------------------------------------
PYRG_LACAC      ----------------------------------------------------------------------
GUAA_SYNP6      ----------------------------------------------------------------------
GUAA_SHEFN      ----------------------------------------------------------------------
GUAA_PSYA2      ----------------------------------------------------------------------
GUAA_PSESM      ----------------------------------------------------------------------
GUAA_PSE14      ----------------------------------------------------------------------
GUAA_NEIMB      ----------------------------------------------------------------------
GUAA_KLULA      ----------------------------------------------------------------------
GUAA_ENTS8      ----------------------------------------------------------------------
GUAA_AZOSE      ----------------------------------------------------------------------
GUAAA_META3     ----------------------------------------------------------------------
GUAAA_IGNH4     ----------------------------------------------------------------------
TRPG_HELPY      ----------------------------------------------------------------------
PYRG_LACSS      ----------------------------------------------------------------------
GUAA_SYNS3      ----------------------------------------------------------------------
GUAA_PSEFS      ----------------------------------------------------------------------
GUAA_PSEF5      ----------------------------------------------------------------------
GUAA_PECCP      ----------------------------------------------------------------------
GUAA_NEIMF      ----------------------------------------------------------------------
GUAA_NEIMA      ----------------------------------------------------------------------
GUAA_NEIM0      ----------------------------------------------------------------------
GUAA_MARAV      ----------------------------------------------------------------------
GUAA_ERWCT      ----------------------------------------------------------------------
GUAA_BURPS      ----------------------------------------------------------------------
GUAA_BURP1      ----------------------------------------------------------------------
TRPG_HELPJ      ----------------------------------------------------------------------
PYRG_STAHJ      ----------------------------------------------------------------------
PYRG_LACBA      ----------------------------------------------------------------------
PYRG_BACLD      ----------------------------------------------------------------------
PHZB_PSECL      ----------------LIGSDGKGGRSLDSAI----LIRTADIDNSGEVRI-----SVGSTIVRHSDPMT
GUAA_YEAST      ----------------------------------------------------------------------
GUAA_BURP6      ----------------------------------------------------------------------
GUAA_BURP0      ----------------------------------------------------------------------
GUAA_BURMS      ----------------------------------------------------------------------
GUAA_BURMA      ----------------------------------------------------------------------
GUAA_BURM9      ----------------------------------------------------------------------
GUAA_BURM7      ----------------------------------------------------------------------
GUAA_BURCH      ----------------------------------------------------------------------
GUAA_BURCC      ----------------------------------------------------------------------
GUAA_BURCA      ----------------------------------------------------------------------
PYRG_PSEU5      ----------------------------------------------------------------------
PYRG_PSEMY      ----------------------------------------------------------------------
GUAA_SHESR      ----------------------------------------------------------------------
GUAA_SHESM      ----------------------------------------------------------------------
GUAA_SHESA      ----------------------------------------------------------------------
GUAA_SHEON      ----------------------------------------------------------------------
GUAA_PSEPF      ----------------------------------------------------------------------
GUAA_HAEIG      ----------------------------------------------------------------------
GUAA_FRAP2      ----------------------------------------------------------------------
GUAA_EMENI      ----------------------------------------------------------------------
GUAA_CHLPN      ----------------------------------------------------------------------
GUAAA_SULTO     ----------------------------------------------------------------------
PYRG_PHOLL      ----------------------------------------------------------------------
GUAA_RHOPB      ----------------------------------------------------------------------
GUAA_COLP3      ----------------------------------------------------------------------
GUAAA_METB6     ----------------------------------------------------------------------
YA14_SCHPO      ----------------------------------------------------------------------
TRPG_CRYNE      ----------------------------------------------------------------------
PYRG_ERWT9      ----------------------------------------------------------------------
HIS5_HALMA      ----------------------------------------------------------------------
GUAA_METPP      ----------------------------------------------------------------------
GUAA_CAUCR      ----------------------------------------------------------------------
GUAA_CAUCN      ----------------------------------------------------------------------
YL126_YEAST     ----------------------------------------------------------------------
TRPG_CRYNV      ----------------------------------------------------------------------
PYRG_YERPY      ----------------------------------------------------------------------
PYRG_YERPS      ----------------------------------------------------------------------
PYRG_YERPP      ----------------------------------------------------------------------
PYRG_YERPN      ----------------------------------------------------------------------
PYRG_YERPG      ----------------------------------------------------------------------
PYRG_YERPE      ----------------------------------------------------------------------
PYRG_YERPB      ----------------------------------------------------------------------
PYRG_YERPA      ----------------------------------------------------------------------
PYRG_YERP3      ----------------------------------------------------------------------
PYRG_STRA3      ----------------------------------------------------------------------
PYRG_STRA1      ----------------------------------------------------------------------
PYRG_LISMO      ----------------------------------------------------------------------
PYRG_EDWI9      ----------------------------------------------------------------------
PYRG_AERHH      ----------------------------------------------------------------------
GUAA_SHESW      ----------------------------------------------------------------------
GUAA_SHEPC      ----------------------------------------------------------------------
GUAA_SHEAM      ----------------------------------------------------------------------
GUAA_BAUCH      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
CARA_ECOLI      ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
CARA_ECO57      ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
CARA_ECOL6      ALALEKA