[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ecol0:AAC74699.1

[Show Plain Result]


## Summary of Sequence Search
    1::193
    1::193     6e-96 100%  193 aa  RNFA_SHIDS RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_SHIB3 RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECOSM RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECOSE RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECOLU RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECOLI RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECOLC RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECOL6 RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECOL5 RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECOHS RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECODH RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECOBW RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECO8A RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECO81 RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECO7I RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECO5E RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECO57 RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECO55 RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECO27 RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-96 100%  193 aa  RNFA_ECO24 RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-95  99%  193 aa  RNFA_ECOUT RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-95  99%  193 aa  RNFA_ECOK1 RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-95  99%  193 aa  RNFA_ECO45 RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-95  99%  193 aa  RNFA_SHISS RecName: Full=Electron transport complex protein rnfA;
    1::193     2e-95  99%  193 aa  RNFA_SHIFL RecName: Full=Electron transport complex protein rnfA;
    1::193     2e-95  99%  193 aa  RNFA_SHIF8 RecName: Full=Electron transport complex protein rnfA;
    1::193     2e-95  92%  193 aa  RNFA_SHIBS RecName: Full=Electron transport complex protein rnfA;
    1::193     2e-95  99%  193 aa  RNFA_ESCF3 RecName: Full=Electron transport complex protein rnfA;
    1::193     7e-95  99%  193 aa  RNFA_CITK8 RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALTY RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALTI RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALSV RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALPK RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALPC RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALPB RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALPA RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALNS RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALHS RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALG2 RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALEP RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALDC RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALCH RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-94  98%  193 aa  RNFA_SALA4 RecName: Full=Electron transport complex protein rnfA;
    1::193     7e-94  97%  193 aa  RNFA_SALAR RecName: Full=Electron transport complex protein rnfA;
    1::193     7e-94  97%  193 aa  RNFA_KLEP3 RecName: Full=Electron transport complex protein
    1::192     6e-86  89%  193 aa  RNFA_YERPY RecName: Full=Electron transport complex protein rnfA;
    1::192     6e-86  89%  193 aa  RNFA_YERPN RecName: Full=Electron transport complex protein rnfA;
    1::192     6e-86  89%  193 aa  RNFA_YERPG RecName: Full=Electron transport complex protein rnfA;
    1::192     6e-86  89%  193 aa  RNFA_YERPE RecName: Full=Electron transport complex protein rnfA;
    1::192     6e-86  89%  193 aa  RNFA_YERPB RecName: Full=Electron transport complex protein rnfA;
    1::192     6e-86  89%  193 aa  RNFA_YERPA RecName: Full=Electron transport complex protein rnfA;
    1::192     6e-86  89%  193 aa  RNFA_YERP3 RecName: Full=Electron transport complex protein rnfA;
    1::192     6e-86  89%  193 aa  RNFA_YERE8 RecName: Full=Electron transport complex protein rnfA;
    1::192     5e-85  88%  193 aa  RNFA_YERPP RecName: Full=Electron transport complex protein rnfA;
    1::192     6e-85  88%  193 aa  RNFA_PHOLL RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-84  87%  193 aa  RNFA_SODGM RecName: Full=Electron transport complex protein rnfA;
    1::193     2e-84  88%  193 aa  RNFA_PROMH RecName: Full=Electron transport complex protein rnfA;
    1::192     2e-84  89%  193 aa  RNFA_ENTS8 RecName: Full=Electron transport complex protein rnfA;
    1::192     3e-81  82%  193 aa  RNFA_ERWT9 RecName: Full=Electron transport complex protein rnfA;
    1::192     9e-81  85%  193 aa  RNFA_EDWI9 RecName: Full=Electron transport complex protein rnfA;
    1::193     5e-79  81%  193 aa  RNFA_VIBCH RecName: Full=Electron transport complex protein rnfA;
    1::192     3e-78  80%  192 aa  RNFA_VIBHB RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-78  74%  193 aa  RNFA_AERHH RecName: Full=Electron transport complex protein rnfA;
    1::192     7e-78  81%  193 aa  RNFA_ERWCT RecName: Full=Electron transport complex protein
    1::192     3e-77  82%  193 aa  RNFA_SERP5 RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-77  79%  193 aa  RNFA_ALISL RecName: Full=Electron transport complex protein rnfA;
    1::192     4e-77  79%  192 aa  RNFA_VIBVY RecName: Full=Electron transport complex protein rnfA;
    1::192     4e-77  79%  192 aa  RNFA_VIBVU RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-77  78%  193 aa  RNFA_VIBF1 RecName: Full=Electron transport complex protein rnfA;
    1::192     6e-77  80%  193 aa  RNFA_PECCP RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-76  73%  193 aa  RNFA_AERS4 RecName: Full=Electron transport complex protein rnfA;
    1::192     2e-75  79%  193 aa  RNFA_PSEA6 RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-75  70%  193 aa  RNFA_HAES2 RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-75  70%  193 aa  RNFA_HAES1 RecName: Full=Electron transport complex protein rnfA;
   26::192     5e-75  81%  192 aa  RNFA_VIBSL RecName: Full=Electron transport complex protein rnfA;
   26::192     2e-74  79%  192 aa  RNFA_VIBPA RecName: Full=Electron transport complex protein rnfA;
    1::192     7e-74  77%  192 aa  RNFA_THISH RecName: Full=Electron transport complex protein rnfA;
    1::191     9e-73  70%  193 aa  RNFA_MARAV RecName: Full=Electron transport complex protein
    1::192     2e-72  76%  192 aa  RNFA_SHEPC RecName: Full=Electron transport complex protein rnfA;
    1::192     5e-72  75%  192 aa  RNFA_SHESW RecName: Full=Electron transport complex protein rnfA;
    1::192     5e-72  75%  192 aa  RNFA_SHEB9 RecName: Full=Electron transport complex protein rnfA;
    1::192     5e-72  75%  192 aa  RNFA_SHEB8 RecName: Full=Electron transport complex protein rnfA;
    1::192     1e-71  75%  192 aa  RNFA_SHESR RecName: Full=Electron transport complex protein rnfA;
    1::192     1e-71  75%  192 aa  RNFA_SHESM RecName: Full=Electron transport complex protein rnfA;
    1::192     1e-71  75%  192 aa  RNFA_SHESA RecName: Full=Electron transport complex protein rnfA;
    1::192     1e-71  75%  192 aa  RNFA_SHEON RecName: Full=Electron transport complex protein rnfA;
    1::192     1e-71  75%  192 aa  RNFA_SHESH RecName: Full=Electron transport complex protein rnfA;
    1::192     1e-71  75%  192 aa  RNFA_SHEAM RecName: Full=Electron transport complex protein rnfA;
    1::192     5e-71  74%  192 aa  RNFA_SHEPA RecName: Full=Electron transport complex protein rnfA;
    1::192     5e-71  74%  192 aa  RNFA_SHEB2 RecName: Full=Electron transport complex protein rnfA;
    1::192     9e-71  74%  192 aa  RNFA_SHEDO RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-70  66%  193 aa  RNFA_HAHCH RecName: Full=Electron transport complex protein rnfA;
   26::191     7e-70  75%  192 aa  RNFA_SHELP RecName: Full=Electron transport complex protein rnfA;
   26::192     6e-69  74%  192 aa  RNFA_SHEPW RecName: Full=Electron transport complex protein rnfA;
    1::192     2e-67  73%  193 aa  RNFA_PSEHT RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-67  65%  194 aa  RNFA_PSEAE RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-67  65%  194 aa  RNFA_PSEAB RecName: Full=Electron transport complex protein rnfA;
    1::193     3e-67  65%  194 aa  RNFA_PSEA8 RecName: Full=Electron transport complex protein rnfA;
    1::193     5e-67  64%  194 aa  RNFA_PSEA7 RecName: Full=Electron transport complex protein rnfA;
    1::192     5e-67  65%  192 aa  RNFA_HAEIG RecName: Full=Electron transport complex protein rnfA;
    1::192     5e-67  65%  192 aa  RNFA_HAEIE RecName: Full=Electron transport complex protein rnfA;
    1::192     5e-67  65%  192 aa  RNFA_HAEI8 RecName: Full=Electron transport complex protein rnfA;
    1::192     1e-66  65%  192 aa  RNFA_HAEIN RecName: Full=Electron transport complex protein rnfA;
    1::194     2e-66  72%  194 aa  RNFA_ALCBS RecName: Full=Electron transport complex protein
    1::194     3e-65  63%  194 aa  RNFA_PSEMY RecName: Full=Electron transport complex protein rnfA;
    1::192     4e-63  63%  192 aa  RNFA_PASMU RecName: Full=Electron transport complex protein rnfA;
    1::190     5e-63  60%  193 aa  RNFA_AZOSB RecName: Full=Electron transport complex protein
    1::193     5e-63  67%  193 aa  RNFA_ALHEH RecName: Full=Electron transport complex protein rnfA;
    1::193     7e-63  61%  194 aa  RNFA_AZOVD RecName: Full=Electron transport complex protein
    1::193     2e-59  67%  193 aa  RNFA_COLP3 RecName: Full=Electron transport complex protein rnfA;
    1::193     6e-59  66%  193 aa  RNFA_TOLAT RecName: Full=Electron transport complex protein rnfA;
    1::192     4e-58  63%  192 aa  RNFA_PSYIN RecName: Full=Electron transport complex protein rnfA;
    1::193     4e-58  58%  193 aa  RNFA_HAEPS RecName: Full=Electron transport complex protein rnfA;
    1::193     2e-55  57%  193 aa  RNFA_HAEDU RecName: Full=Electron transport complex protein rnfA;
    1::176     8e-54  56%  193 aa  RNFA_PELCD RecName: Full=Electron transport complex protein rnfA;
    1::191     2e-53  52%  193 aa  RNFA_AZOSE RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-52  48%  193 aa  RNFA_BUCAT RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-52  48%  193 aa  RNFA_BUCAI RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-52  48%  193 aa  RNFA_BUCA5 RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-52  54%  193 aa  RNFA_ACTPJ RecName: Full=Electron transport complex protein rnfA;
    1::193     1e-52  54%  193 aa  RNFA_ACTP2 RecName: Full=Electron transport complex protein rnfA;
    1::190     9e-52  52%  193 aa  RNFA_RHOS4 RecName: Full=Electron transport complex protein
    1::190     9e-52  52%  193 aa  RNFA_RHOS1 RecName: Full=Electron transport complex protein
    1::176     9e-47  52%  193 aa  RNFA_RHOCA RecName: Full=Electron transport complex protein
    5::193     1e-46  47%  194 aa  RNFA_BUCBP RecName: Full=Electron transport complex protein rnfA;
   26::193     1e-40  45%  193 aa  RNFA_BUCAP RecName: Full=Electron transport complex protein rnfA;
    1::200     2e-36  43%  202 aa  NQRE_METCA RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     2e-36  43%  198 aa  NQRE_AERS4 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     4e-36  42%  198 aa  NQRE_AERHH RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     7e-36  41%  198 aa  NQRE_VIBAN RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     9e-36  42%  198 aa  NQRE_HAES1 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     1e-35  42%  198 aa  NQRE_SERP5 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     1e-35  42%  198 aa  NQRE_PHOPR RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     1e-35  42%  198 aa  NQRE_HAES2 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     2e-35  40%  198 aa  NQRE_PROMH RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::195     6e-35  41%  197 aa  NQRE_NEIMF RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::195     6e-35  41%  197 aa  NQRE_NEIM0 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     6e-35  41%  198 aa  NQRE_HAEIG RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     6e-35  41%  198 aa  NQRE_HAEIE RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     6e-35  41%  198 aa  NQRE_HAEI8 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     8e-35  41%  198 aa  NQRE_YERE8 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     8e-35  42%  202 aa  NQRE_PSEU5 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     1e-34  40%  202 aa  NQRE_SHEDO RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     1e-34  40%  198 aa  NQRE_PHOLL RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::195     1e-34  41%  197 aa  NQRE_NEIMB RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     1e-34  41%  202 aa  NQRE_AZOVD RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     2e-34  42%  198 aa  NQRE_MANSM RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::195     2e-34  40%  197 aa  NQRE_NEIG2 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::195     2e-34  40%  197 aa  NQRE_NEIG1 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::195     3e-34  40%  197 aa  NQRE_NEIMA RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     3e-34  40%  198 aa  NQRE_HAEIN RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     5e-34  39%  198 aa  NQRE_VIBCM RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     5e-34  39%  198 aa  NQRE_VIBCH RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     5e-34  39%  198 aa  NQRE_VIBC3 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     5e-34  41%  202 aa  NQRE_PSEA6 RecName: Full=Na(+)-translocating NADH-quinone reductase
   26::200     5e-34  42%  202 aa  NQRE_CELJU RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     7e-34  41%  202 aa  NQRE_PSEAE RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     7e-34  41%  202 aa  NQRE_PSEAB RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     7e-34  41%  202 aa  NQRE_PSEA8 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     7e-34  41%  202 aa  NQRE_PSEA7 RecName: Full=Na(+)-translocating NADH-quinone reductase
   26::200     7e-34  43%  202 aa  NQRE_DESAD RecName: Full=Na(+)-translocating NADH-quinone reductase
    5::211     9e-34  42%  213 aa  NQRE_RHOBA RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     1e-33  41%  198 aa  NQRE_TOLAT RecName: Full=Na(+)-translocating NADH-quinone reductase
   33::209     3e-33  42%  244 aa  NQRE_CHLTB RecName: Full=Na(+)-translocating NADH-quinone reductase
   33::209     3e-33  42%  244 aa  NQRE_CHLT2 RecName: Full=Na(+)-translocating NADH-quinone reductase
   33::209     3e-33  42%  244 aa  NQRE_CHLTR RecName: Full=Probable Na(+)-translocating NADH-quinone
   33::209     3e-33  42%  244 aa  NQRE_CHLTA RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     4e-33  39%  198 aa  NQRE_YERPP RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     4e-33  39%  198 aa  NQRE_YERPN RecName: Full=Na(+)-translocating NADH-quinone reductase
   26::200     1e-32  41%  202 aa  NQRE_NITEU RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     4e-32  40%  202 aa  NQRE_PSYIN RecName: Full=Na(+)-translocating NADH-quinone reductase
    5::197     5e-32  36%  199 aa  NQRE_YERPE RecName: Full=Na(+)-translocating NADH-quinone reductase
   33::209     5e-32  40%  244 aa  NQRE_CHLMU RecName: Full=Probable Na(+)-translocating NADH-quinone
    1::201     6e-32  39%  203 aa  NQRE_DICNV RecName: Full=Na(+)-translocating NADH-quinone reductase
   33::209     1e-31  39%  264 aa  NQRE_CHLCV RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     1e-31  39%  202 aa  NQRE_PSYWF RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     3e-31  41%  202 aa  NQRE_PSEHT RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     4e-31  39%  198 aa  NQRE_PASMU RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     5e-31  39%  198 aa  NQRE_VIBSL RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     7e-31  39%  198 aa  NQRE_ACTPJ RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     7e-31  39%  198 aa  NQRE_ACTP2 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     1e-30  37%  198 aa  NQRE_VIBFM RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     1e-30  37%  198 aa  NQRE_VIBF1 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     2e-30  38%  198 aa  NQRE_HAEPS RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     2e-30  39%  202 aa  NQRE_IDILO RecName: Full=Na(+)-translocating NADH-quinone reductase
    5::204     2e-30  40%  206 aa  NQRE_CHRSD RecName: Full=Na(+)-translocating NADH-quinone reductase
   33::209     2e-30  39%  256 aa  NQRE_CHLPN RecName: Full=Probable Na(+)-translocating NADH-quinone
    1::200     4e-30  39%  202 aa  NQRE_PSEMY RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     4e-30  38%  198 aa  NQRE_ALISL RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     6e-30  39%  198 aa  NQRE_ACTSZ RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     8e-30  36%  202 aa  NQRE_TERTT RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     2e-29  38%  202 aa  NQRE_ALTMD RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     2e-29  40%  202 aa  NQRE_PSYCK RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     2e-29  40%  202 aa  NQRE_PSYA2 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     3e-29  36%  198 aa  NQRE_VIBVY RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     3e-29  36%  198 aa  NQRE_VIBVU RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     4e-29  37%  198 aa  NQRE_VIBPA RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     5e-29  37%  198 aa  NQRE_VIBHB RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     5e-29  37%  198 aa  NQRE_VIBAL RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     5e-29  37%  198 aa  NQRE_KLEP7 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::196     1e-28  37%  198 aa  NQRE_HAEDU RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::200     1e-28  38%  202 aa  NQRE_MARAV RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::205     9e-28  36%  207 aa  NQRE_COLP3 RecName: Full=Na(+)-translocating NADH-quinone reductase
   27::201     6e-27  41%  203 aa  NQRE_HAHCH RecName: Full=Na(+)-translocating NADH-quinone reductase
   78::204     4e-25  45%  206 aa  NQRE_ALCBS RecName: Full=Na(+)-translocating NADH-quinone reductase
   77::200     1e-23  44%  202 aa  NQRE_SACD2 RecName: Full=Na(+)-translocating NADH-quinone reductase
   28::154     1e-18  39%  238 aa  RNFE_CELJU RecName: Full=Electron transport complex protein rnfE;
   27::153     5e-16  37%  243 aa  RNFE_RHOCA RecName: Full=Electron transport complex protein
   26::152     6e-16  37%  228 aa  RNFE_ALISL RecName: Full=Electron transport complex protein rnfE;
   38::164     2e-15  39%  224 aa  RNFE_PASMU RecName: Full=Electron transport complex protein rnfE;
   50::174     5e-15  34%  235 aa  RNFE_HAEIN RecName: Full=Electron transport complex protein rnfE;
   49::173     5e-15  34%  234 aa  RNFE_HAEIG RecName: Full=Electron transport complex protein rnfE;
   50::174     5e-15  34%  235 aa  RNFE_HAEI8 RecName: Full=Electron transport complex protein rnfE;
   26::150     7e-15  34%  230 aa  RNFE_VIBVY RecName: Full=Electron transport complex protein rnfE;
   26::150     7e-15  34%  230 aa  RNFE_VIBVU RecName: Full=Electron transport complex protein rnfE;
   26::152     9e-15  35%  227 aa  RNFE_VIBFM RecName: Full=Electron transport complex protein rnfE;
   26::152     9e-15  35%  227 aa  RNFE_VIBF1 RecName: Full=Electron transport complex protein rnfE;
   28::152     9e-15  35%  238 aa  RNFE_MARAV RecName: Full=Electron transport complex protein
   26::150     2e-14  33%  230 aa  RNFE_VIBCM RecName: Full=Electron transport complex protein rnfE;
   26::150     2e-14  33%  230 aa  RNFE_VIBCH RecName: Full=Electron transport complex protein rnfE;
   26::150     2e-14  33%  230 aa  RNFE_VIBC3 RecName: Full=Electron transport complex protein rnfE;
   50::174     3e-14  34%  235 aa  RNFE_HAEIE RecName: Full=Electron transport complex protein rnfE;
   26::150     3e-14  33%  230 aa  RNFE_VIBPA RecName: Full=Electron transport complex protein rnfE;
   39::165     6e-14  38%  238 aa  RNFE_AZOVD RecName: Full=Electron transport complex protein
   25::151     1e-13  33%  223 aa  RNFE_BUCAP RecName: Full=Electron transport complex protein rnfE;
   31::152     6e-13  34%  231 aa  RNFE_SHEDO RecName: Full=Electron transport complex protein rnfE;
   27::153     2e-12  31%  223 aa  RNFE_MAGSA RecName: Full=Electron transport complex protein
   40::167     7e-12  38%  241 aa  RNFE_PSEST RecName: Full=Electron transport complex protein
   31::152     5e-11  31%  232 aa  RNFE_SHESW RecName: Full=Electron transport complex protein rnfE;
   31::152     5e-11  31%  232 aa  RNFE_SHEPC RecName: Full=Electron transport complex protein rnfE;
   34::117     6e-11  38%  240 aa  RNFE_PSEAE RecName: Full=Electron transport complex protein rnfE;
   34::117     6e-11  38%  238 aa  RNFE_PSEA8 RecName: Full=Electron transport complex protein rnfE;
   26::150     8e-11  31%  230 aa  RNFE_VIBSL RecName: Full=Electron transport complex protein rnfE;
   67::152     1e-10  36%  232 aa  RNFE_SHELP RecName: Full=Electron transport complex protein rnfE;
   85::168     1e-10  38%  227 aa  RNFE_HAEDU RecName: Full=Electron transport complex protein rnfE;
   34::117     2e-10  37%  238 aa  RNFE_PSEAB RecName: Full=Electron transport complex protein rnfE;
   29::153     3e-10  32%  210 aa  NQRD_PSEA6 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     4e-10  31%  210 aa  NQRD_ALTMD RecName: Full=Na(+)-translocating NADH-quinone reductase
   67::152     5e-10  36%  231 aa  RNFE_SHEPA RecName: Full=Electron transport complex protein rnfE;
   67::150     5e-10  38%  233 aa  RNFE_ERWT9 RecName: Full=Electron transport complex protein rnfE;
   67::152     7e-10  36%  232 aa  RNFE_SHEAM RecName: Full=Electron transport complex protein rnfE;
   49::152     9e-10  36%  231 aa  RNFE_SHEPW RecName: Full=Electron transport complex protein rnfE;
   31::113     9e-10  36%  232 aa  RNFE_SHEB9 RecName: Full=Electron transport complex protein rnfE;
   31::113     9e-10  36%  232 aa  RNFE_SHEB8 RecName: Full=Electron transport complex protein rnfE;
   31::113     9e-10  36%  232 aa  RNFE_SHEB2 RecName: Full=Electron transport complex protein rnfE;
   67::152     9e-10  37%  228 aa  RNFE_ENTS8 RecName: Full=Electron transport complex protein rnfE;
   69::152     1e-09  40%  228 aa  RNFE_THISH RecName: Full=Electron transport complex protein rnfE;
   67::152     2e-09  38%  232 aa  RNFE_KLEP3 RecName: Full=Electron transport complex protein
    1::150     2e-09  31%  241 aa  RNFE_BUCBP RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALTY RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALTI RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALSV RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALPK RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALPC RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALPB RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALPA RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALNS RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALHS RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALG2 RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALEP RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALDC RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALCH RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALAR RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  38%  230 aa  RNFE_SALA4 RecName: Full=Electron transport complex protein rnfE;
   86::169     3e-09  35%  229 aa  RNFE_HAEPS RecName: Full=Electron transport complex protein rnfE;
   29::153     3e-09  32%  208 aa  NQRD_PASMU RecName: Full=Na(+)-translocating NADH-quinone reductase
   67::152     3e-09  37%  233 aa  RNFE_YERPY RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  37%  233 aa  RNFE_YERPP RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  37%  233 aa  RNFE_YERPN RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  37%  233 aa  RNFE_YERPG RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  37%  233 aa  RNFE_YERPE RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  37%  233 aa  RNFE_YERPB RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  37%  233 aa  RNFE_YERPA RecName: Full=Electron transport complex protein rnfE;
   67::152     3e-09  37%  233 aa  RNFE_YERP3 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_SHISS RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_SHIDS RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_SHIBS RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_SHIB3 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOUT RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOSM RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOSE RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOLU RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOLI RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOLC RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOL6 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOL5 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOK1 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOHS RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECODH RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECOBW RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECO8A RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECO81 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECO7I RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECO5E RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECO57 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECO55 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECO45 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECO27 RecName: Full=Electron transport complex protein rnfE;
   67::150     3e-09  38%  231 aa  RNFE_ECO24 RecName: Full=Electron transport complex protein rnfE;
   67::150     4e-09  38%  231 aa  RNFE_SHIF8 RecName: Full=Electron transport complex protein rnfE;
   29::153     4e-09  33%  215 aa  NQRD_TOLAT RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-09  28%  208 aa  NQRD_NEIMF RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-09  28%  208 aa  NQRD_NEIMB RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-09  28%  208 aa  NQRD_NEIMA RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-09  28%  208 aa  NQRD_NEIM0 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-09  28%  208 aa  NQRD_NEIG1 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-09  30%  208 aa  NQRD_HAEIN RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-09  30%  208 aa  NQRD_HAEIG RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-09  30%  208 aa  NQRD_HAEIE RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-09  30%  208 aa  NQRD_HAEI8 RecName: Full=Na(+)-translocating NADH-quinone reductase
   67::150     1e-08  38%  230 aa  RNFE_ESCF3 RecName: Full=Electron transport complex protein rnfE;
   67::150     1e-08  38%  230 aa  RNFE_CITK8 RecName: Full=Electron transport complex protein rnfE;
   69::117     1e-08  45%  239 aa  RNFE_PSEA7 RecName: Full=Electron transport complex protein rnfE;
   49::152     2e-08  34%  232 aa  RNFE_SHESR RecName: Full=Electron transport complex protein rnfE;
   49::152     2e-08  34%  232 aa  RNFE_SHESM RecName: Full=Electron transport complex protein rnfE;
   49::152     2e-08  34%  232 aa  RNFE_SHESA RecName: Full=Electron transport complex protein rnfE;
   29::153     4e-08  31%  210 aa  NQRD_VIBPA RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     4e-08  31%  210 aa  NQRD_VIBHB RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     4e-08  31%  210 aa  NQRD_VIBAL RecName: Full=Na(+)-translocating NADH-quinone reductase
   66::151     5e-08  36%  227 aa  RNFE_BUCAT RecName: Full=Electron transport complex protein rnfE;
   66::151     5e-08  36%  227 aa  RNFE_BUCAI RecName: Full=Electron transport complex protein rnfE;
   66::151     5e-08  36%  227 aa  RNFE_BUCA5 RecName: Full=Electron transport complex protein rnfE;
   29::153     6e-08  30%  210 aa  NQRD_VIBVU RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::155     6e-08  31%  210 aa  NQRD_VIBFM RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::155     6e-08  31%  210 aa  NQRD_VIBF1 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     6e-08  29%  210 aa  NQRD_SHEFN RecName: Full=Na(+)-translocating NADH-quinone reductase
   28::152     6e-08  29%  207 aa  NQRD_HAEDU RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::155     8e-08  31%  210 aa  NQRD_PHOPR RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::155     8e-08  31%  210 aa  NQRD_AERS4 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::155     1e-07  31%  210 aa  NQRD_AERHH RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     1e-07  37%  209 aa  NQRD_YERPY RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     1e-07  37%  209 aa  NQRD_YERPS RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     1e-07  37%  209 aa  NQRD_YERPP RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     1e-07  37%  209 aa  NQRD_YERPN RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     1e-07  37%  209 aa  NQRD_YERPG RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     1e-07  37%  209 aa  NQRD_YERPE RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     1e-07  37%  209 aa  NQRD_YERPB RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     1e-07  37%  209 aa  NQRD_YERPA RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     1e-07  37%  209 aa  NQRD_YERP3 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     1e-07  30%  210 aa  NQRD_VIBVY RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     1e-07  29%  210 aa  NQRD_SHEPW RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     1e-07  31%  210 aa  NQRD_PSEHT RecName: Full=Na(+)-translocating NADH-quinone reductase
   67::152     2e-07  33%  231 aa  RNFE_SHEFN RecName: Full=Electron transport complex protein rnfE;
   29::118     2e-07  36%  209 aa  NQRD_YERE8 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::155     2e-07  30%  210 aa  NQRD_VIBCM RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::155     2e-07  30%  210 aa  NQRD_VIBCH RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::155     2e-07  30%  210 aa  NQRD_VIBC3 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     2e-07  29%  210 aa  NQRD_SHEPA RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     2e-07  34%  210 aa  NQRD_SHEDO RecName: Full=Na(+)-translocating NADH-quinone reductase
   67::115     2e-07  41%  232 aa  RNFE_PSEA6 RecName: Full=Electron transport complex protein rnfE;
   29::155     2e-07  30%  210 aa  NQRD_VIBSL RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::155     2e-07  30%  210 aa  NQRD_VIBAN RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     2e-07  32%  213 aa  NQRD_CHLFF RecName: Full=Na(+)-translocating NADH-quinone reductase
   49::113     3e-07  43%  232 aa  RNFE_SHEON RecName: Full=Electron transport complex protein rnfE;
   29::153     3e-07  28%  210 aa  NQRD_SHELP RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     3e-07  29%  223 aa  NQRD_PSEA7 RecName: Full=Na(+)-translocating NADH-quinone reductase
   67::115     4e-07  43%  232 aa  RNFE_SODGM RecName: Full=Electron transport complex protein rnfE;
   67::115     4e-07  43%  236 aa  RNFE_EDWI9 RecName: Full=Electron transport complex protein rnfE;
   30::154     4e-07  28%  224 aa  NQRD_PSEAE RecName: Full=Na(+)-translocating NADH-quinone reductase
   30::154     4e-07  28%  224 aa  NQRD_PSEAB RecName: Full=Na(+)-translocating NADH-quinone reductase
   30::154     4e-07  28%  224 aa  NQRD_PSEA8 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     5e-07  27%  210 aa  NQRD_SHEHH RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     5e-07  28%  213 aa  NQRD_CHLCV RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     7e-07  27%  210 aa  NQRD_SHESH RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     9e-07  33%  209 aa  NQRD_PROMH RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     9e-07  33%  209 aa  NQRD_PHOLL RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     2e-06  26%  210 aa  NQRD_SHEWM RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     2e-06  34%  209 aa  NQRD_SERP5 RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::153     2e-06  28%  213 aa  NQRD_CHLPN RecName: Full=Probable Na(+)-translocating NADH-quinone
   44::153     2e-05  29%  213 aa  NQRD_CHLMU RecName: Full=Probable Na(+)-translocating NADH-quinone
   44::153     2e-05  31%  213 aa  NQRD_CHLAB RecName: Full=Na(+)-translocating NADH-quinone reductase
   29::118     5e-05  30%  210 aa  NQRD_PSYIN RecName: Full=Na(+)-translocating NADH-quinone reductase
   24::134     6e-05  28%  347 aa  Y576_METJA RecName: Full=Uncharacterized transporter MJ0576;
   44::153     8e-05  27%  213 aa  NQRD_CHLTR RecName: Full=Probable Na(+)-translocating NADH-quinone
   44::153     8e-05  27%  213 aa  NQRD_CHLTB RecName: Full=Na(+)-translocating NADH-quinone reductase
   44::153     8e-05  27%  213 aa  NQRD_CHLTA RecName: Full=Na(+)-translocating NADH-quinone reductase
   44::153     8e-05  27%  213 aa  NQRD_CHLT2 RecName: Full=Na(+)-translocating NADH-quinone reductase
    1::193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_SHIDS      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_SHIB3      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOSM      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOSE      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOLU      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOLI      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOLC      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOL6      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOL5      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOHS      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECODH      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOBW      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECO8A      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECO81      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECO7I      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECO5E      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECO57      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECO55      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECO27      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECO24      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOUT      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECOK1      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ECO45      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_SHISS      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_SHIFL      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLTSICAWLIDTWILIPLNLI
RNFA_SHIF8      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLTSICAWLIDTWILIPLNLI
RNFA_SHIBS      MTDYLLLFVGTILVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_ESCF3      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
RNFA_CITK8      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALTY      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALTI      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALSV      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALPK      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALPC      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALPB      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALPA      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALNS      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALHS      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALG2      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALEP      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALDC      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALCH      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALA4      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLI
RNFA_SALAR      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLDLV
RNFA_KLEP3      MADYLLLFIGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLV
RNFA_YERPY      MTEYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLI
RNFA_YERPN      MTEYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLI
RNFA_YERPG      MTEYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLI
RNFA_YERPE      MTEYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLI
RNFA_YERPB      MTEYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLI
RNFA_YERPA      MTEYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLI
RNFA_YERP3      MTEYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLI
RNFA_YERE8      MTEYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLV
RNFA_YERPP      MTEYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLI
RNFA_PHOLL      MTDYFLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGFATTFVMTLASVCSWLVNTFILLPLDLI
RNFA_SODGM      MNGYLMLFIGTXXXXXXXXXXXXXXCPFMGVSKKVETALGMGMATTFVMTLASICAWLINDFILLPLNIP
RNFA_PROMH      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGFATTFVMTIASISSWLMDTFILVPLDLL
RNFA_ENTS8      MTDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLESAIGMGMATTFVMTLATIFSWIIDHLILVPLELV
RNFA_ERWT9      MTEYLLLFIGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVITLASICAWLVNHLILLPLDLV
RNFA_EDWI9      MTDYXXXXXXXXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVLTLASVCAWAVNQFILVPLGLA
RNFA_VIBCH      MTEYLLLLIGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAYLVESYVLRPLGIE
RNFA_VIBHB      MTEYILLLVGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTLASVCAYLVESYVLRPLGIE
RNFA_AERHH      MTEYLLLLVGTVLINNFVLVKFLGLCPFMGVSGKLETAIGMGLATTFVMTLASACSYLMEHYILIPLNIA
RNFA_ERWCT      MTEYALLFVSIXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGMATTFVMTLGSMFSWLINEFILVPLDIL
RNFA_SERP5      MTEYLLLFVGTXXXXXXXXXXXXXXCPFLGVSKKLESAIGMGMATTFVMTLASVSAWVINTFILVPLDLV
RNFA_ALISL      MTEYLLLLIGTXXXXXXXXXXXXXXCPFMGVSKKLESAIGMGLATTFVLTLASVCSYLIETYILAPLGIE
RNFA_VIBVY      MTEYILLLIGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTMASVCAYLVESYILEPLHIE
RNFA_VIBVU      MTEYILLLIGTXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGLATTFVLTMASVCAYLVESYILEPLHIE
RNFA_VIBF1      MTEYLLLLIGTXXXXXXXXXXXXXXCPFMGVSKKLESAIGMGLATTFVLTLASVCSYLVETYILSPLGIE
RNFA_PECCP      MTEYALLFVSIXXXXXXXXXXXXXXCPFMGVSKKLETAIGMGMATTFVMTVGSMFSWLVNEFILVPLDIL
RNFA_AERS4      MTEYLLLLVSTVLINNFVLVKFLGLCPFMGVSGKLETAVGMGLATTFVMTLASASSYLMEHYILIPLNIA
RNFA_PSEA6      MTEFLLLLIGTXXXXXXXXXXXXXXCPFMGVSGKLETAIGMSMATTFVLTLASLSSYLVEHYILLPLGIE
RNFA_HAES2      MIDYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMGLATMFVLTVASLCAYLVERYLLTPLHAN
RNFA_HAES1      MIDYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMGLATMFVLTVASLCAYLVEHYLLTPLHAN
RNFA_VIBSL      -------------------------CPFMGVSKKLETAIGMGLATTFVLTLASVSAYLVETYILTPLGIE
RNFA_VIBPA      -------------------------CPFMGVSKKLETAIGMGLATTFVLTLASVCAYLVESYILRPLGIE
RNFA_THISH      MTEYALILISTXXXXXXXXXXXXXXCPFMGVSRKVETATGMGLATTFVLTLSSVCSYLVNEYLLAPLGLE
RNFA_MARAV      MTEYLLILVSTILVNNFVLVQFLGLCPFMGVSGKLETAMGMSLATTFVLTLSSVCSYLAYTYLLAPLDLA
RNFA_SHEPC      MTEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLS
RNFA_SHESW      MTEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLS
RNFA_SHEB9      MTEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLS
RNFA_SHEB8      MTEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLS
RNFA_SHESR      MSEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLG
RNFA_SHESM      MSEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLG
RNFA_SHESA      MSEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLS
RNFA_SHEON      MSEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLG
RNFA_SHESH      MSEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASVLSYLVNQYLLLPFELG
RNFA_SHEAM      MSEYLLLLIGTXXXXXXXXXXXXXXCPFMGVSGKLESAIGMSMATTFVLTLASVLSFLVNQYLLAPFDLT
RNFA_SHEPA      MSEYLLLLIGTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLG
RNFA_SHEB2      MNEYLLLLISTXXXXXXXXXXXXXXCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLS
RNFA_SHEDO      MTEYLLLLIGTXXXXXXXXXXXXXXCPFMGVSSKLASAIGMSMATTFVLTLASVLSFLTNEFLLQPFSLE
RNFA_HAHCH      MTEYLLILVSTILVNNFVLVQFLGLCPFMGVSNKLETAMGMSLATTFVLTLSSLCSYLAYEYLLAPLGME
RNFA_SHELP      -------------------------CPFMGVSSKLESAIGMSMATTFVLTLASILSYLVDTYLLTPFDLS
RNFA_SHEPW      -------------------------CPFMGVSSKLESAIGMSMATTFVLTLASILSYLVNQYLLLPFDLG
RNFA_PSEHT      MTEYVLLLIGTXXXXXXXXXXXXXXCPFMGVSSKLDTAIGMSLATTFVLTLASVTSYLVNQYILIPLDIT
RNFA_PSEAE      MTELALILVSAILVNNFVLVQFLGLCPFMGVSRKIETAIGLSLATTFVLTLAAMCSHILQRYVLRPLDLE
RNFA_PSEAB      MTELALILVSAILVNNFVLVQFLGLCPFMGVSRKIETAIGLSLATTFVLTLAAMCSHILQRYVLRPLDLE
RNFA_PSEA8      MTELALILVSAILVNNFVLVQFLGLCPFMGVSRKIETAIGLSLATTFVLTLAAMCSHILQRYVLRPLDLE
RNFA_PSEA7      MTELALILVSAILVNNFVLVQFLGLCPFMGVSRKIETAIGLSLATTFVLTLAAICSYILQRYVLRPLDLE
RNFA_HAEIG      MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVDHYILIPLNAT
RNFA_HAEIE      MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVDHYILIPLNAT
RNFA_HAEI8      MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVDHYILIPLNAT
RNFA_HAEIN      MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLATMFVLTVASLCAYLVDHYILIPLNAT
RNFA_ALCBS      MTEYVLILISAXXXXXXXXXXXXXXCPFMGVSNKVETAMGMSLATTFVLTLSSVLAYLTWAYILVPFELE
RNFA_PSEMY      MTELVLIMVSAILVNNFVLVQFLGLCPFMGVSKKIETAIGLSLATTFVLTLAAMCSYLVQQYVLKPLDLE
RNFA_PASMU      MTEYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMSLATMFVLTVASISAYLIDTYILTPLSAT
RNFA_AZOSB      MSEWLMLLLGTALVNNVVLVKFLGLCPFMGVSKKVDSAIGMGMATTFVLTLASALTWLIEHFLLVPFDFG
RNFA_ALHEH      MTELALILVSTXXXXXXXXXXXXXXCPFMGVSRQLETAMGMALATTFVLTLSAVCSYLAYEYLLAPLGVE
RNFA_AZOVD      MTELVLILVGAILVNNFVLVQFLGLCPFMGVSKRIETAIGXXXXXXXXXXXXXMCSYLLQRYVLVPLDLE
RNFA_COLP3      MTDYXXXXXXXXXXXXXXXXXXXXXCPFMGVSSRTETAIGMSFATVFVMTXXXXXXXXXXXXXXXXXXXE
RNFA_TOLAT      MLEYLLLLISTXXXXXXXXXXXXXXCPFMGVSKKIEPAVGMGLATTFVLTLTSAFAYLVQHYLLVPLAAE
RNFA_PSYIN      MSDYFLLFIGTXXXXXXXXXXXXXXCPFMGVSNKIETAVGMXXXXXXXXXXXXXXXYIVNKYILLPLDLV
RNFA_HAEPS      MVEYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVETYLLIPLEAE
RNFA_HAEDU      MVDYILLVISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTLASLSAYLVERFILIPLDAQ
RNFA_PELCD      MKNLLLILIGAVLVNNFVLARFLGLCPFLGVSRKVETALGMGMAVTFVMVVASGCTWVLQYLVLTPYHLD
RNFA_AZOSE      MHEYALLLLSTALVNNVVLVKFLGLCPAMGVSKSMDAALGMGLATTFVITLAAAASWMLEHWLLAPFDLG
RNFA_BUCAT      MKHYILFFISNILIENFILVKFLGLCPFLGASSNIETAFGMSCATTFVILTSSVLLWCVNFFILLPLDLI
RNFA_BUCAI      MKHYILFFISNILIENFILVKFLGLCPFLGASSNIETAFGMSCATTFVILTSSVLLWCVNFFILLPLDLI
RNFA_BUCA5      MKHYILFFISNILIENFILVKFLGLCPFLGASSNIETAFGMSCATTFVILTSSVLLWCVNFFILLPLDLI
RNFA_ACTPJ      MVDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVETYVLIPLEAQ
RNFA_ACTP2      MVDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVETYVLIPLEAQ
RNFA_RHOS4      MGDFFFILLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVLTLAAGASWMVEALILEPLDLT
RNFA_RHOS1      MGDFFFILLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVLTLAAGASWMVEALILEPLDLT
RNFA_RHOCA      MQDFLLVLLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVITVASAACWLVEALILEPLDLK
RNFA_BUCBP      ---FFLLFVSNILINNFILVRFLGLCPFMGISRTIDSAIGMGLATTCVIVFVSIISWLINFYILIPFHLI
RNFA_BUCAP      -------------------------CPFIGASNQIKQAFGISFAXXXXXXXXXXXXXXXNFFILLPFDLV
NQRE_METCA      MEAYINLFIKSVFIENMALSFFLGMCTFIAVSKKIETAVGLGIAVVIVQTLTVPANNLIYTYLLKEVDLS
NQRE_AERS4      MEHYLSLLIRSIFIENLALSFFLGMCTFLAVSKKVKTAMGLGIAVIVVQTVAVPANNLIYNYVLKDLDLS
NQRE_AERHH      MEHYISLLIRSIFIENLALSFFLGMCTFLAVSKKVKTAMGLGIAVIVVQTVAVPANNLIYNYVLKDLDLS
NQRE_VIBAN      MEHYISLLVRSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGIAVTVVLTISXXXXXXXXXXXXKPIDLT
NQRE_HAES1      MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGISVPVNQLVYSLILKDVDLS
NQRE_SERP5      MEHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTLVLGISVPVNNLVYNLILRDVDLS
NQRE_PHOPR      MEHYLSLLVRSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVIVVLTIAIPVNNLVDGAIVDGVDLT
NQRE_HAES2      MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGISVPVNQLVYSLILKDVDLS
NQRE_PROMH      MEHYISLFVRAVFIENMALAFFLGMCTFLAVSKNVKTAFGLGIAVTVVLGLSVPLNNLVYNYVLRAVDLS
NQRE_NEIMF      MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVVYSLLKDGAIVEGVDLT
NQRE_NEIM0      MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVVYSLLKDGAIVEGVDLT
NQRE_HAEIG      MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVTFVLGIAVPVNQLIENALIEGVDLS
NQRE_HAEIE      MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVTFVLGIAVPVNQLIENALIEGVDLS
NQRE_HAEI8      MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVTFVLGIAVPVNQLIENALIEGVDLS
NQRE_YERE8      MEHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVDGALVEGVDLS
NQRE_PSEU5      MEHYISLFVRAVFIENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIYTYLLLPVDLS
NQRE_SHEDO      MEHYISLLIRSVFIENMALSFFLGMCTFLAVSKKVTTAMGLGVAVIVVLAISVPANQIIYQGILAPADLS
NQRE_PHOLL      MEHFISLFVRAVFIENMALAFFLGMCTFLAVSKNVTTAFGLGIAVTVVLGISVPANNLVDGALVEGVDLS
NQRE_NEIMB      MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVVYSLLKDGAIAEGVDLT
NQRE_AZOVD      MEHYISLFVKSVFIENMALAFFLGMCTFIAISKKVETAIGLGIAVVVVQAITVLYAYLLKAWAGLPIDLS
NQRE_MANSM      MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGISVPVNQLVYTHILKDVDLS
NQRE_NEIG2      MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVVYSLLKDGAIVEGVDLT
NQRE_NEIG1      MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVVYSLLKDGAIVEGVDLT
NQRE_NEIMA      MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVVYSLLKDGAIVEGVDLT
NQRE_HAEIN      MEHYISLFVKAVFIENMALSFFLGMCTFLAVSKKVSPAFGLGIAVTFVLGIAVPVNQLIENALIEGVDLS
NQRE_VIBCM      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGIAVIVVLTISVPXXXXXXXXXXKPVDLS
NQRE_VIBCH      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGIAVIVVLTISVPXXXXXXXXXXKPVDLS
NQRE_VIBC3      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGIAVIVVLTISVPXXXXXXXXXXKPVDLS
NQRE_PSEA6      MEQYLSLFIRSIFLENMALFYFLGMCTFLAVSKKVKTAMGLGVAVIVVLTISVPVNQLVYANILAPTDLS
NQRE_CELJU      -------------------------CSFLAMSKKINAAIGLGIAVIVVQTVTVPANNLLLTYLLTGVDLT
NQRE_PSEAE      MEHYISLFVKAVFVENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIYTYLLLPVDLS
NQRE_PSEAB      MEHYISLFVKAVFVENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIYTYLLLPVDLS
NQRE_PSEA8      MEHYISLFVKAVFVENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIYTYLLLPVDLS
NQRE_PSEA7      MEHYISLFVKAVFVENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIYTYLLLPVDLS
NQRE_DESAD      -------------------------CTYLAVSKKVQTSMGLGVAVIVVMTITVPVNNLLYNYFLRETDLT
NQRE_RHOBA      ---YLSVFLKAVFVENLALAFFLGMCTFLAVSKNVKTAIGLGIAVIAIETITVPANQLIDTYNFAEVDLT
NQRE_TOLAT      MEHYLSLFVKSIFIENLALSFFLGMCTFLAVSKKVKTAMGLGXXXXXXXXXXXXXNNLVFTYVLKEMDLT
NQRE_CHLTB      -------------------------CSYLACSSRLSTANGLGMSVALVLTITGSINWLVHYFITKPIDLS
NQRE_CHLT2      -------------------------CSYLACSSRLSTANGLGMSVALVLTITGSINWLVHYFITKPIDLS
NQRE_CHLTR      -------------------------CSYLACSSRLSTANGLGMSVALVLTITGSINWLVHYFITKPIDLS
NQRE_CHLTA      -------------------------CSYLACSSRLSTANGLGMSVALVLTITGSINWLVHYFITKPIDLS
NQRE_YERPP      MEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVDGALVEGVDLS
NQRE_YERPN      MEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVDGALVEGVDLS
NQRE_NITEU      -------------------------CTFLAISKKIEVAFGMGIAVIVVQTLTVPINNLVYQYLLAEIDLT
NQRE_PSYIN      MEHYISIFVRSIFMENMALAFFLGMCTFLAVSKKVKTSMXXXXXXXXXXXXXXXXNQIIYFNLLAPADLS
NQRE_YERPE      ---YLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILREVDLS
NQRE_CHLMU      -------------------------CSYLACSSRLSTANGLGMSVALVLTITGSINWLIHHFVTGPIDLS
NQRE_DICNV      MEHYLSLLIKSIFIENMALSFFLGMCTFLAVSKKISTAIGLGTAVIVVQXXXXXXXXXXDNAILVNVDIS
NQRE_CHLCV      -------------------------CSYLACSARVSTANGLGMSVALVLTVTGSINWVVHTFITGPVNLN
NQRE_PSYWF      MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSTAIGLGVAVIVVMSITVPLNNLLFQFILKDIDLS
NQRE_PSEHT      MEHYISLFVKAVFIENLALSFFLGMCTFLAVSKKVTTXXXXXXXXXXXLVYHAVLAPGSLTWLGYPADLS
NQRE_PASMU      MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFXXXXXXXXXXXXXXPVNQLVYSFILKDIDLS
NQRE_VIBSL      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFXXXXXXXXXXXXXXXXNNLVYTHILKEVDLS
NQRE_ACTPJ      MEHYLSLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFXXXXXXXXXXXXXXPANQLVYTHVLKDVDLS
NQRE_ACTP2      MEHYLSLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFXXXXXXXXXXXXXXPANQLVYTHVLKDVDLS
NQRE_VIBFM      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFXXXXXXXXXXXXXXXXNNLVYTYLLAGVDLT
NQRE_VIBF1      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFXXXXXXXXXXXXXXXXNNLVYTYLLAGVDLT
NQRE_HAEPS      MEHYLSLFVKSIFIENMALSFFLGMCTFLAVSKKVSTAFXXXXXXXXXXXXXXPANQIVDGALVEGVDLT
NQRE_IDILO      MENYINLFIRAVFIENLALSFFLGMCTFLAVSKKVKTAFXXXXXXXXXXXXXXXXNNLIYHNILAPADLS
NQRE_CHRSD      ---YLSLFVKAVFVENMALAFFLGMCTFLAVSKKISSXXXXXXXXXXXXXXXXPVNNLILTYLLSEIDLS
NQRE_CHLPN      -------------------------CSYLACSTRVSTANGLGMSVALVLTVTGSINWFVHTWILASVNLG
NQRE_PSEMY      MEHYISLFVRAVFVENMALAFFLGMCTFIAISKKVETXXXXXXXXXXXLIYANILKDGALAWAGLPVDLS
NQRE_ALISL      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFXXXXXXXXXXXXXXXXXXXXYTYLLKDVDLS
NQRE_ACTSZ      MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTSFXXXXXXXXXXXXXXPVNQLVYTHILKEVDLS
NQRE_TERTT      MADLIALFVRSVFIENMALAFFLGMCTFLAVSKKVDAAIGLGXXXXXXXXXXXXXNNLLYTYFLADVDLS
NQRE_ALTMD      MEHYLSLFVRSIFVENMALSLFLGMCTFLAVSKKVKTAMXXXXXXXXXXXXXXXXNQIIYVNILAPADLS
NQRE_PSYCK      MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSXXXXXNLLFQFILKDGALA------WAGFPIDLS
NQRE_PSYA2      MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSXXXXXNLLFQFILKDGALA------WAGFPIDLS
NQRE_VIBVY      MEHYISLLIKSIFIENMALSFFLGMCTFLAVSKKVKTSFXXXXXXXXXXXXXXXXXXXXENALVEGVDLS
NQRE_VIBVU      MEHYISLLIKSIFIENMALSFFLGMCTFLAVSKKVKTSFXXXXXXXXXXXXXXXXXXXXENALVEGVDLS
NQRE_VIBPA      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFXXXXXXXXXXXXXXXXXXXXENALVEGVDLS
NQRE_VIBHB      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFXXXXXXXXXXXXXXXXXXXXENALVEGVDLS
NQRE_VIBAL      MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFXXXXXXXXXXXXXXXXXXXXENALVEGVDLS
NQRE_KLEP7      MAHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSXXXXXXXXXXXXXXXXXPINNLVDGALVEGVDLS
NQRE_HAEDU      MEHLLSIFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFXXXXXXXXXXXXXXPVNQLVYTHILKDVDLS
NQRE_MARAV      MEHYLSLLLKAIFVENMALAFFLGMCTFLAISKKIEAATGLGIAXXXXXXXXXXXXXXXXXXILLPVDLS
NQRE_COLP3      MEHYLSIFIKTIFIENMALSFFLGMCTFLAVSKKVSTAIXXXXXXXXXXXXXXPANQIIYQAILAPIDLS
NQRE_HAHCH      -------------------------CTFLALSKKMEAAIGLGIAXXXXXXXXAIYNGLLRSWAGLPVDLS
NQRE_ALCBS      ---------------------------------------------------------------LASLDLR
NQRE_SACD2      ------------------------------------------------------------------VDLS
RNFE_CELJU      -------------------------CPLLAVSSSVVNALGLGIATLLVLVISNSFVSLIRRQVSDAVRLP
RNFE_RHOCA      -------------------------CPTLAITGTATNGLGMGLATTVVLILSNVVISALRKTIAPEI---
RNFE_ALISL      -------------------------CPLLAVSATVTNALGLGIATTLVLIGSNLIVSLVRQWI--PQEV-
RNFE_PASMU      -------------------------CPLLAVSNSVTNALGLGIATLFVLTVVSLFRKQIPHEIRIPI---
RNFE_HAEIN      -------------------------CPLLAVSSTATNALGLGLATMLVLTCTNTVISLFRQYI--PKEI-
RNFE_HAEIG      -------------------------CPLLAVSSTATNALGLGLATMLVLTCTNTVISLFRQYI--PKEI-
RNFE_HAEI8      -------------------------CPLLAVSSTATNALGLGLATMLVLTCTNTVISLFRQYI--PKEI-
RNFE_VIBVY      -------------------------CPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLIRNYV--PKEI-
RNFE_VIBVU      -------------------------CPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLIRNYV--PKEI-
RNFE_VIBFM      -------------------------CPLLAVSATVTNALGLGIATILVLVGSNLIVSLVRQWI--PQEV-
RNFE_VIBF1      -------------------------CPLLAVSATVTNALGLGIATILVLVGSNLIVSLVRQWI--PQEV-
RNFE_MARAV      -------------------------CPLLAVTSTVVNAIGLGLATLLVLMGSNLSVSLIRNFVSESVRLP
RNFE_VIBCM      -------------------------CPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLVRDYV--PKEV-
RNFE_VIBCH      -------------------------CPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLVRDYV--PKEV-
RNFE_VIBC3      -------------------------CPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLVRDYV--PKEV-
RNFE_HAEIE      -------------------------CPLLAVSSTATNALGLSLATMLVLTCTNTVISLFRQYI--PKEI-
RNFE_VIBPA      -------------------------CPLLAVSSTITNALGLGIATLLVLVGSNVTVSLIRNYV--PKEI-
RNFE_AZOVD      -------------------------CPTLAVTTTATNGLGMGLATTLVLVMTNALISSMRHTISPEV---
RNFE_BUCAP      -------------------------CPILAMTTNTINAIGLGITTTFVLTITNSIISILKNFI--PKDI-
RNFE_SHEDO      ------------------------------VTATVTNALGLGFATLLVLVGSNMLVSLVRDYV--PKEI-
RNFE_MAGSA      -------------------------CPTMAMTGTATNGLGMGLATAAVMAASNLMVAMFRNYVTHEV---
RNFE_PSEST      -------------------------CPALAVTTTATNGLGMGLATTLVLMITNAIISALRHSISPAV---
RNFE_SHESW      ------------------------------VTATITNALGLGVATMLVLIGSNILVSLVRDYV--PKEI-
RNFE_SHEPC      ------------------------------VTATITNALGLGVATMLVLIGSNILVSLVRDYV--PKEI-
RNFE_PSEAE      -------------------------------SNSTVNALGLGLATMLVLACSNAAVSLVRGAVSEAIRLP
RNFE_PSEA8      -------------------------------SNSTVNALGLGLATMLVLACSNAAVSLVRGAVSEAIRLP
RNFE_VIBSL      -------------------------CPLLAVSSTVTNALGLGIATXXXXXXXXXXXXXXRNHV--PKEV-
RNFE_SHELP      ----------------------------------------------------------------------
RNFE_HAEDU      ----------------------------------------------------------------------
RNFE_PSEAB      -------------------------------SNSTVNALGLGLATMLVLACSNAAVSLVRGAVSEAIRLP
NQRD_PSEA6      -------------------------CSALAVTTKLETALVMSLALTAVTAFSNLFISMIRSQIPSSVRII
NQRD_ALTMD      -------------------------CSALAITTKLETALVMSLALTSVVAFSNLFISLIRNQIPSSVRII
RNFE_SHEPA      ----------------------------------------------------------------------
RNFE_ERWT9      ----------------------------------------------------------------------
RNFE_SHEAM      ----------------------------------------------------------------------
RNFE_SHEPW      ---------------------------------------------------------LIGSNILVSLVRD
RNFE_SHEB9      ------------------------------VTATITNALGLGLATMLVLIGSNILVSLVRDYV--PKEI-
RNFE_SHEB8      ------------------------------VTATITNALGLGLATMLVLIGSNILVSLVRDYV--PKEI-
RNFE_SHEB2      ------------------------------VTATITNALGLGLATMLVLIGSNILVSLVRDYV--PKEI-
RNFE_ENTS8      ----------------------------------------------------------------------
RNFE_THISH      ----------------------------------------------------------------------
RNFE_KLEP3      ----------------------------------------------------------------------
RNFE_BUCBP      MSNILKIFVDGLWKKNSSLVQLLGLCPVLAITVNAINAIGLGLATTLVLICSNATISLIKNNIQKDF---
RNFE_SALTY      ----------------------------------------------------------------------
RNFE_SALTI      ----------------------------------------------------------------------
RNFE_SALSV      ----------------------------------------------------------------------
RNFE_SALPK      ----------------------------------------------------------------------
RNFE_SALPC      ----------------------------------------------------------------------
RNFE_SALPB      ----------------------------------------------------------------------
RNFE_SALPA      ----------------------------------------------------------------------
RNFE_SALNS      ----------------------------------------------------------------------
RNFE_SALHS      ----------------------------------------------------------------------
RNFE_SALG2      ----------------------------------------------------------------------
RNFE_SALEP      ----------------------------------------------------------------------
RNFE_SALDC      ----------------------------------------------------------------------
RNFE_SALCH      ----------------------------------------------------------------------
RNFE_SALAR      ----------------------------------------------------------------------
RNFE_SALA4      ----------------------------------------------------------------------
RNFE_HAEPS      ----------------------------------------------------------------------
NQRD_PASMU      -------------------------CSALAVTTKLETAIVMTFAVIFVTAFSNLFISLIRNYI--PNSV-
RNFE_YERPY      ----------------------------------------------------------------------
RNFE_YERPP      ----------------------------------------------------------------------
RNFE_YERPN      ----------------------------------------------------------------------
RNFE_YERPG      ----------------------------------------------------------------------
RNFE_YERPE      ----------------------------------------------------------------------
RNFE_YERPB      ----------------------------------------------------------------------
RNFE_YERPA      ----------------------------------------------------------------------
RNFE_YERP3      ----------------------------------------------------------------------
RNFE_SHISS      ----------------------------------------------------------------------
RNFE_SHIDS      ----------------------------------------------------------------------
RNFE_SHIBS      ----------------------------------------------------------------------
RNFE_SHIB3      ----------------------------------------------------------------------
RNFE_ECOUT      ----------------------------------------------------------------------
RNFE_ECOSM      ----------------------------------------------------------------------
RNFE_ECOSE      ----------------------------------------------------------------------
RNFE_ECOLU      ----------------------------------------------------------------------
RNFE_ECOLI      ----------------------------------------------------------------------
RNFE_ECOLC      ----------------------------------------------------------------------
RNFE_ECOL6      ----------------------------------------------------------------------
RNFE_ECOL5      ----------------------------------------------------------------------
RNFE_ECOK1      ----------------------------------------------------------------------
RNFE_ECOHS      ----------------------------------------------------------------------
RNFE_ECODH      ----------------------------------------------------------------------
RNFE_ECOBW      ----------------------------------------------------------------------
RNFE_ECO8A      ----------------------------------------------------------------------
RNFE_ECO81      ----------------------------------------------------------------------
RNFE_ECO7I      ----------------------------------------------------------------------
RNFE_ECO5E      ----------------------------------------------------------------------
RNFE_ECO57      ----------------------------------------------------------------------
RNFE_ECO55      ----------------------------------------------------------------------
RNFE_ECO45      ----------------------------------------------------------------------
RNFE_ECO27      ----------------------------------------------------------------------
RNFE_ECO24      ----------------------------------------------------------------------
RNFE_SHIF8      ----------------------------------------------------------------------
NQRD_TOLAT      -------------------------CSALAVTSKMETAFVMALAVTVVTGFSNLFISLIRHIIPNSVRII
NQRD_NEIMF      -------------------------CSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYI--PNSI-
NQRD_NEIMB      -------------------------CSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYI--PNSI-
NQRD_NEIMA      -------------------------CSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYI--PNSI-
NQRD_NEIM0      -------------------------CSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYI--PNSI-
NQRD_NEIG1      -------------------------CSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYI--PNSI-
NQRD_HAEIN      -------------------------CSALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYI--PNSIR
NQRD_HAEIG      -------------------------CSALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYI--PNSIR
NQRD_HAEIE      -------------------------CSALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYI--PNSIR
NQRD_HAEI8      -------------------------CSALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYI--PNSIR
RNFE_ESCF3      ----------------------------------------------------------------------
RNFE_CITK8      ----------------------------------------------------------------------
RNFE_PSEA7      ----------------------------------------------------------------------
RNFE_SHESR      ---------------------------------------------------------LIGSNILVSLVRD
RNFE_SHESM      ---------------------------------------------------------LIGSNILVSLVRD
RNFE_SHESA      ---------------------------------------------------------LIGSNILVSLVRD
NQRD_VIBPA      -------------------------CSALAVTTKLETAFVMTLAVTFVTALSNFSVSLIRNHIPNSVRII
NQRD_VIBHB      -------------------------CSALAVTTKLETAFVMTLAVTFVTALSNFSVSLIRNHIPNSVRII
NQRD_VIBAL      -------------------------CSALAVTTKLETAFVMTLAVTFVTALSNFSVSLIRNHIPNSVRII
RNFE_BUCAT      ----------------------------------------------------------------------
RNFE_BUCAI      ----------------------------------------------------------------------
RNFE_BUCA5      ----------------------------------------------------------------------
NQRD_VIBVU      -------------------------CSALAVTTKLETAFVMTLAVTFVTALSNFFVSLIRNHIPNSVRII
NQRD_VIBFM      -------------------------CSALAVTTKLETAFVMTLAVMFVTALSNLFVSLIRNHMPNSVRII
NQRD_VIBF1      -------------------------CSALAVTTKLETAFVMTLAVMFVTALSNLFVSLIRNHMPNSVRII
NQRD_SHEFN      -------------------------CSALAVTSKLETALVMTIALTAVTAFSNLFISLIRNHIPSSVRII
NQRD_HAEDU      -------------------------CSALAVTTQLQTAFVMAIAVSLVTAFSSMFISMIRNYI--PNSI-
NQRD_PHOPR      -------------------------CSALAVTTKLETAFVMTLAVMFVTAFSNLFVSLIRNHIPNSVRII
NQRD_AERS4      -------------------------CSALAVTSQMKTAFVMTLAVTAVTAFSNLFISLIRNQI--PNSV-
NQRD_AERHH      -------------------------CSALAVTSQMKTAFVMTLAVTAVTAFSNLFISLIRNQI--PNSV-
NQRD_YERPY      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_YERPS      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_YERPP      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_YERPN      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_YERPG      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_YERPE      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_YERPB      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_YERPA      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_YERP3      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_VIBVY      -------------------------CSALAVTTKLETAFVMTLAVTFVTALSNFFVSVIRNHIPNSVRII
NQRD_SHEPW      -------------------------CSALAVTSKMETALVMTIALTAVCALSNLFISLIRNHIPSSVRII
NQRD_PSEHT      -------------------------CSALAVTSSLKNALIMSIALTLVTAFSSFFISTIRNQIPSSVRII
RNFE_SHEFN      ----------------------------------------------------------------------
NQRD_YERE8      -------------------------CSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHI--PNSV-
NQRD_VIBCM      -------------------------CSALAVTTKLETAFVMTLAVMFVTALSNFFVSLIRNHIPNSVRII
NQRD_VIBCH      -------------------------CSALAVTTKLETAFVMTLAVMFVTALSNFFVSLIRNHIPNSVRII
NQRD_VIBC3      -------------------------CSALAVTTKLETAFVMTLAVMFVTALSNFFVSLIRNHIPNSVRII
NQRD_SHEPA      -------------------------CSALAVTSKMETALVMTIALTAVCALSNLFISLIRNHIPSSVRII
NQRD_SHEDO      -------------------------CSALAVTSKMETALVMSLALTVVTAFSNLFISLIRNHIPSSVRII
RNFE_PSEA6      ----------------------------------------------------------------------
NQRD_VIBSL      -------------------------CSALAVTTKLETAFVMTIAVMFVTALSNFFVSLIRNHIPNSVRII
NQRD_VIBAN      -------------------------CSALAVTTKLETAFVMTLAVMFVTAFSNLFVSLIRHHIPNSVRII
NQRD_CHLFF      -------------------------CSALAVTTTVKTAITMGLAVSFVTGCSSFFVSLLRK--ITPDSVR
RNFE_SHEON      ---------------------------------------------------------LIGSNVLISLVRD
NQRD_SHELP      -------------------------CSALAVTSKMETALVMTIALTAVTALSNLFISMIRNHIPSSVRII
NQRD_PSEA7      -------------------------CSALAVTSNLKTATVMAIALTLVTGFSNLFISMIRRQI--PSSI-
RNFE_SODGM      ----------------------------------------------------------------------
RNFE_EDWI9      ----------------------------------------------------------------------
NQRD_PSEAE      -------------------------CSALAVTSNLKTATVMAIALTLVTGFSNLFISMIRRQI--PSSI-
NQRD_PSEAB      -------------------------CSALAVTSNLKTATVMAIALTLVTGFSNLFISMIRRQI--PSSI-
NQRD_PSEA8      -------------------------CSALAVTSNLKTATVMAIALTLVTGFSNLFISMIRRQI--PSSI-
NQRD_SHEHH      -------------------------CSALAVTSKMETALVMTIALTVVCAFSNLFISILRNHIPSSVRII
NQRD_CHLCV      -------------------------CSALAVTTTVNTAITMGLAVSFVTGCSSFFVSL-----LRKATPD
NQRD_SHESH      -------------------------CSALAVTSKLETALVMTIALTAVCAFSNLFISMLRNHIPSSVRII
NQRD_PROMH      -------------------------CSALAVTTKLETALVMTIAVTLVTAFSNFFISLIRNYIPGSVRII
NQRD_PHOLL      -------------------------CSALAVTTKLETALVMTIAVTLVTAFSSFFISLIRHYIPGSVRII
NQRD_SHEWM      -------------------------CSALAVTSKMETALVMTIALTAVCACSNLFISMLRNHIPSSVRII
NQRD_SERP5      -------------------------CSALAVTTKLETAVVMTIAVTLVTAFSSFFISLIRHHIPNSVRII
NQRD_CHLPN      -------------------------CSALAVTTTVQTAITMGIAVSIVTGCSSFFVSLLRKFTPDSVRMI
NQRD_CHLMU      ----------------------------------------MGLAVSFVTGFASFVVSLLRK--ITPESV-
NQRD_CHLAB      ----------------------------------------MGLAVSFVTGCSSFFVSL-----LRKVTPD
NQRD_PSYIN      -------------------------CSALAVTSKLENAVVMTVAVLFVTAFSNFFISTIRNYIPNSVRII
Y576_METJA      --------------------------------------MGTGILAVDSLLYSSYLPILKD----VAVGLF
NQRD_CHLTR      ----------------------------------------MGFAVSFVTGCSSFVVSLLRK--ITPESV-
NQRD_CHLTB      ----------------------------------------MGFAVSFVTGCSSFVVSLLRK--ITPESV-
NQRD_CHLTA      ----------------------------------------MGFAVSFVTGCSSFVVSLLRK--ITPESV-
NQRD_CHLT2      ----------------------------------------MGFAVSFVTGCSSFVVSLLRK--ITPESV-


                         .         .         *         .         .         .         .:140
query           YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_SHIDS      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_SHIB3      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOSM      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOSE      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOLU      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOLI      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOLC      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOL6      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOL5      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOHS      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECODH      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOBW      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECO8A      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECO81      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECO7I      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECO5E      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECO57      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECO55      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECO27      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECO24      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOUT      YLRTMAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECOK1      YLRTMAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ECO45      YLRTMAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_SHISS      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_SHIFL      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_SHIF8      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_SHIBS      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_ESCF3      YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_CITK8      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
RNFA_SALTY      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALTI      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALSV      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALPK      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALPC      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALPB      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALPA      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALNS      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALHS      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALG2      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALEP      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALDC      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALCH      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALA4      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_SALAR      YLRTLSFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHHFLQSALYGFSA
RNFA_KLEP3      YLRTLAFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFAA
RNFA_YERPY      YLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNVNQSHNFMQSAVYGFSA
RNFA_YERPN      YLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNVNQSHNFMQSAVYGFSA
RNFA_YERPG      YLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNVNQSHNFMQSAVYGFSA
RNFA_YERPE      YLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNVNQSHNFMQSAVYGFSA
RNFA_YERPB      YLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNVNQSHNFMQSAVYGFSA
RNFA_YERPA      YLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNVNQSHNFMQSAVYGFSA
RNFA_YERP3      YLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNVNQSHNFMQSAVYGFSA
RNFA_YERE8      YLRTLAFILVIAVVVQFTELVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNINQSHNFMQSAVYGFSA
RNFA_YERPP      YLRTLAFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNVNQSHNFMQSAVYGFSA
RNFA_PHOLL      YLRTLSFILVIAVVVQFTELVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNINQSHDFLQSAIYGFGA
RNFA_SODGM      YLRTLAFIFIIAVVVQFTELVVRKTSPALYRLLGIFLPLITTNCAVLGVALLNVNENHNFLQSALYGFSA
RNFA_PROMH      YLRTLSFILVIAVVVQFTEMVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNINQSHTFMQSAVYGFGA
RNFA_ENTS8      YLRTMAFILVIAVVVQFTEMVVRKTSPALYRLLGIYLPLITTNCAVLGVALLSINLNHTFMQSALYGFSA
RNFA_ERWT9      YLRTMAYILVIAVVVQFTEMVVRKTSPDLYRLLGIFLPLITTNCAVLGVPLLSVNLNHTFMQAAIYGFSA
RNFA_EDWI9      YLRTLTFILVIAVVVQFTELAVRKTSPMLYRLLGIFLPLITTNCAVLGVALLNVNQSHNFLQSAVYGFSA
RNFA_VIBCH      YLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVALLNINENHNFIQSIIYGFGA
RNFA_VIBHB      YLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVALLNINENHNFIESIIYGFGA
RNFA_AERHH      YLRTLAFILVIAVVVQFTEMVIRKSSPTLYRLLGIFLPLITTNCAVLGVALLSINEHHNFIQSIIYGFGA
RNFA_ERWCT      YLRTMAFILVLAVVVQFSEMFVRKVSPELYRLLGIFLPLITTNCAVLGVVLLNINLSHGFLQSTIYGFGG
RNFA_SERP5      YLRTLSFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCXXXXXXXXXXXXXYNFLQSAVYGFSA
RNFA_ALISL      YLRTMSFILVIAVVVQFTEMVVHKTSPTLYRVLGIFLPLITTNCAVLGVALLNVTENHNFIESIIYGFGA
RNFA_VIBVY      YLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVALLNINENHSFVESIIYGFGA
RNFA_VIBVU      YLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVALLNINENHSFVESIIYGFGA
RNFA_VIBF1      YLRTMSFILVIAVVVQFTEMVVHKTSPTLYRVLGIFLPLITTNCAVLGVALLNVTENHNFVESIIYGFGA
RNFA_PECCP      YLRTMAFILVLAVVVQFSEMFVRKVSPELYRLLGIFLPLITTNCAVLGVVLLNINLSHGFLKSTIYGFGG
RNFA_AERS4      YLRTLAFILVIAVVVQFTEMVIRKSSPTLYRLLGIFLPLITTNCAVLGVALLSINERHNFIQSIIYGFGA
RNFA_PSEA6      YLRTLSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVALLNINHDHNFIESVIYGFGA
RNFA_HAES2      FLRTLIFILVIAVVVQFTEMVIHKTSPTLYRLLGIFLPLITTNCAVLGVALLNINLAHNLTQSVIYGFSA
RNFA_HAES1      FLRTLIFILVIAVVVQFTEMVIHKTSPTLYRLLGIFLPLITTNCAVLGVALLNINLAHNLTQSVIYGFSA
RNFA_VIBSL      YLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVALLNINENHNFIQSIIYGFGA
RNFA_VIBPA      YLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVALLNINENHNFIESIIYGFGA
RNFA_THISH      YLRTIAFILVIAAVVQFTEMVVHKTSPLLYNVLGIFLPLITTNCAVLGVALLNVQEAHGFIESALYGLGA
RNFA_MARAV      FLKTITFILVIAVVVQFTEMVVRKTSPLLYRVLGIFLPLITTNCAVLGVALLNLNKNNNFVESVLYGFGA
RNFA_SHEPC      YLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVALLNVNEKHDFIQSAIYGFGA
RNFA_SHESW      YLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVALLNVNEKHDFIQSAIYGFGA
RNFA_SHEB9      YLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVALLNVNEKHDFIQSAIYGFGA
RNFA_SHEB8      YLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVALLNVNEKHDFIQSAIYGFGA
RNFA_SHESR      YLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVALLNVNEKHDFIQSAIYGFGA
RNFA_SHESM      YLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVALLNVNEKHDFIQSAIYGFGA
RNFA_SHESA      YLRTMSFILVIAVVVQFTEMVVQKTSASLHRALGIYLPLITTNCAVLGVALLNVNEKHDFIQSAIYGFGA
RNFA_SHEON      YLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVALLNVNEKHDFIQSAIYGFGA
RNFA_SHESH      YLRTMSFILVIAVVVQFTEMLVQKTSASLYRALGIYLPLITTNCAVLGVALLNISEKHNFIESAIYGFGA
RNFA_SHEAM      YLRTMSFILVIAVVVQFTEMLVQKTSASLHRALGIYLPLITTNCAVLGVALLNVNEQHDFLESAIYGFGA
RNFA_SHEPA      YLRTMSFILVIAVVVQFTEMLVQKTSASLHRALGIYLPLITTNCAVLGVALLNINEKHGFIESAIFGFGA
RNFA_SHEB2      YLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVALLNVNEKHDFIQSAIFGFGA
RNFA_SHEDO      YLRTMSFILVIAVVVQFTEMLVQKTSASLHRALGIYLPLITTNCAVLGVALLNINEDHNFIESAIYGFGA
RNFA_HAHCH      FLKTITFILVIAVVVQFTEMVIKKTSPLLYRVLGIFLPLITTNCAVLGVALLNIKKQNDFMESILYGFGA
RNFA_SHELP      YLRTMAFILVIAVVVQFTEMLVQKTSAALHRALGIYLPLITTNCAVLGVALLNVNEKHDFIESAIYGFGA
RNFA_SHEPW      YLRTMSFILVIAVVVQFTEMLVQKTSASLHRALGIYLPLITTNCAVLGVALLNINEDHNFFESAIFGFGA
RNFA_PSEHT      YLRTMSFILVIAVVVQFTEMVVRKTSPTLYRLLGIFLPLITTNCAVLGVALLNIKEDHSFLQSAVYGFGA
RNFA_PSEAE      YLRTIGFILVIAVVVQFTEMLVKKTSPLLYRVLGIFLPLITTNCIVLGVALLNANKAYGFLQATTQGFGA
RNFA_PSEAB      YLRTIGFILVIAVVVQFTEMLVKKTSPLLYRVLGIFLPLITTNCIVLGVALLNANKAYGFLQATTQGFGA
RNFA_PSEA8      YLRTIGFILVIAVVVQFTEMLVKKTSPLLYRVLGIFLPLITTNCIVLGVALLNANKAYGFLQATTQGFGA
RNFA_PSEA7      FLRTIGFILVIAVVVQFTEMLVKKTSPLLYRVLGIFLPLITTNCIVLGVALLNANRAYGFLEATTQGFGA
RNFA_HAEIG      FLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCXXXXXXXXXXXXXXXXTESVVYGFGA
RNFA_HAEIE      FLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCXXXXXXXXXXXXXXXXTESVVYGFGA
RNFA_HAEI8      FLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCXXXXXXXXXXXXXXXXTESVVYGFGA
RNFA_HAEIN      FLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLGIFLPLITTNCXXXXXXXXXXXXXXXXTESVVYGFGA
RNFA_ALCBS      YLRTISFILVIAVAVQFTEMFVKKASPLLYRVLGVFLPLITSNCAVLGVALLNVRQDATFMSSLTYGFGA
RNFA_PSEMY      FLRTISFILVIAVTVQFTEMVVNKTSPLLYRVLGIFLPLITTNCIVLGVALLNANKAETFITATVNGFAA
RNFA_PASMU      FLRTLVFILVIAVVVQFTEMVINKTSPTLYRLLGIFLPLITTNCAVLGVALLNINQAHTLTQSVIYGFGA
RNFA_AZOSB      YLRILSFILVIAATVQFVEMVIKKTAPDLYKVLGIYLPLITTNCAVLGVALLNAGEGAGFVRSVLYGFGS
RNFA_ALHEH      YLRTITFIMVIAVVVQFTEMAVRKTSPLLHQVLGIYLPLITTNCAVLGVAXXXXXXXXXXXXXAVYGFGA
RNFA_AZOVD      YLRTIGFILVIAVVVQFTEMLVNKTSPLLYRVLGIFLPLITTNCIVLGVALLNANAGYGFLESGINGFGA
RNFA_COLP3      YLTTMSFILVIAVVVQFTEMVVHKTSASLYRLLGIFLPLITTNCAVLGVALLNLRLQHGFFESIIYGFGA
RNFA_TOLAT      SLSTLAFILVIAVVVQFTEMVIHKSAPDLYRILGIYLPLITTNCIVLGLALLNITMQHNFMQSXXXXXXX
RNFA_PSYIN      YLQTIGFILVIAVVVQFTEMVMHKTSPTLYRLLGIFLPLITTNCAILGLALLNINEDHDFVESIIYGFXX
RNFA_HAEPS      FLRTLVFILVIAVIVQLTEMIVHKTSSALYRLLGIYLPLITTXXXXXXXXXXXXXXXXXXXXXXXYGFGA
RNFA_HAEDU      FLRTLVFILVIAVIVQLTEMIVHKTSPTLYRLLGIYLPLITTNCAXXXXXXXXXXXXXXXXXXXXYGFGA
RNFA_PELCD      YLQTIAFILVIATLVQMVEMIVRKSSPVLYQSLGIFLPLITTNCAVLGLAVLNIQQGYSFVQSLVFAFGG
RNFA_AZOSE      FLRILSFILVIAAAVQFTEMAIRKMSPALYQSLGIYLPLITTNCAVLGVALLNVQQGYGFFKSVLFGFGS
RNFA_BUCAT      YLRIIAYMLIVSVSVQFLEIVLRKTSPILYRLLGIFLPLITTNCTVLAIPLFSLYEHHTFLESIFYGLSA
RNFA_BUCAI      YLRIIAYMLIVSVSVQFLEIVLRKTSPILYRLLGIFLPLITTNCTVLAIPLFSLYEHHTFLESIFYGLSA
RNFA_BUCA5      YLRIIAYMLIVSVSVQFLEIVLRKTSPILYRLLGIFLPLITTNCTVLAIPLFSLYEHHTFLESIFYGLSA
RNFA_ACTPJ      FLRTLVFILVIAVIVQLTEMIVHKTSPTLYRLLGIYLPLITTXXXXXXXXXXXXXXXXXXXXXXXYGFGA
RNFA_ACTP2      FLRTLVFILVIAVIVQLTEMIVHKTSPTLYRLLGIYLPLITTXXXXXXXXXXXXXXXXXXXXXXXYGFGA
RNFA_RHOS4      FXXXXXXXXXXXXXXQFIEVVMRKLAPGLHRALGIYLPLITTNCAVLGVALLNIQEGHGLASSLLYGFGS
RNFA_RHOS1      FXXXXXXXXXXXXXXQFIEVVMRKLAPGLHRALGIYLPLITTNCAVLGVALLNIQEGHGLASSLLYGFGS
RNFA_RHOCA      FLRILSMILVIAAIVQFIETVMRKVTPDLHKALGIYLPLITTNCAVLGLPLMYIQGHLSLAMSTLSGFGA
RNFA_BUCBP      HLCTMTYMLIIAVSVQIFEIIVKKVSSTLYRLLGIYLPLITTNCSVLAIPLMNTKLNSNFIESVLYGFSS
RNFA_BUCAP      YLRIIVYMLIISFGVQLIEIILRGTSPILYRILGIFLPLITTNCAVLAIPLFSLYLNHTFLESILYAVSA
NQRE_METCA      FIALMACIGVIAAMVQILEMVLDKFFPALYNALGIFLPLITVNCAILAGSLFMIERDYNFSESVVYGVGS
NQRE_AERS4      FLSFITFIGVIAALVQILEMALDKYFPALYNALGIFLPLITVNCAIFGGVSFMVQRDYNFVESVVYGVGS
NQRE_AERHH      FLSFITFIGVIAALVQILEMALDKYFPALYNALGIFLPLITVNCAIFGGVSFMVQRDYNFVESVVYGVGS
NQRE_VIBAN      FLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESVVYGFGS
NQRE_HAES1      FLNFITFIGVIAALVQILEMILDKYFPALYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESVVYGIGA
NQRE_SERP5      FLNFITFIGVIAALVQILEMILDRFFPSLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESVVYGFGS
NQRE_PHOPR      FLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFVESIVYGFGS
NQRE_HAES2      FLNFITFIGVIAALVQILEMILDKYFPALYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESIVYGIGA
NQRE_PROMH      FLNFITFIGVIAALVQILEMILDRYFPSLYNALGIFLPLITVNCAIFGGVSFMAQRDYNFSESIVYGFGS
NQRE_NEIMF      FLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYNFGESVVYGFGA
NQRE_NEIM0      FLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYNFGESVVYGFGA
NQRE_HAEIG      FLNFITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGS
NQRE_HAEIE      FLNFITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGS
NQRE_HAEI8      FLNFITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGS
NQRE_YERE8      FLNFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVNCAIFGGVSFMAQRDYNFPESIVYGFGS
NQRE_PSEU5      FLGLLSYIGVIAAIVQILEMTLDKYVPSLYNALGVFLPLITVNCAIMGGTLFMVERDYNLGESVVYGMGS
NQRE_SHEDO      FLKFITFIGVIAALVQILEMTLDKYFPPLYNALGIFLPLITVNCAIFGAVAFMVERDYNLTESLVFGVGS
NQRE_PHOLL      FLNFITFIGVIAALVQILEMILDRYFPSLYNALGIFLPLITVNCAIFGGVSFMAQRDYNFSESIVYGFGS
NQRE_NEIMB      FLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYNFGESVVYGFGA
NQRE_AZOVD      FLGFLSYIGVIAAIVQILEMLLDKYVPSLYNALGIYLPLITVNCAIMAGSLFMVERDYNFPESVVYGIGS
NQRE_MANSM      FLNFITFIGVIAALVQILEMFLDKFVPSLYEALGIFLPLITVNCAIFGGVSFMVQREYNFPESVVYGIGA
NQRE_NEIG2      FLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYDFGESVVYGFGA
NQRE_NEIG1      FLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYDFGESVVYGFGA
NQRE_NEIMA      FLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCAIFGAVSFMAQREYGFGESVVYGFGA
NQRE_HAEIN      FLNFITFIGVIAGLVQILEMVLDKFMPSLYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGS
NQRE_VIBCM      FLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYSFAESVVYGFGS
NQRE_VIBCH      FLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYSFAESVVYGFGS
NQRE_VIBC3      FLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYSFAESVVYGFGS
NQRE_PSEA6      FLSFLTFIGVIAALVQILEMTLDKFFPALYNALGIFLPLITVNCAIFGGVAFAVQRDYTFTESIFYGAGS
NQRE_CELJU      FLSFISFIGVIAAIVQIMEMVMDKYMPALYNALGVFLPLITVNCVIMGGSLFMVERDYHFAESVVYGFGS
NQRE_PSEAE      FLGLLSYIGVIAAIVQILEMLLDKYVPSLYNALGVFLPLITVNCAIMAGSLFMVERDYNLAESTVYGVGS
NQRE_PSEAB      FLGLLSYIGVIAAIVQILEMLLDKYVPSLYNALGVFLPLITVNCAIMAGSLFMVERDYNLAESTVYGVGS
NQRE_PSEA8      FLGLLSYIGVIAAIVQILEMLLDKYVPSLYNALGVFLPLITVNCAIMAGSLFMVERDYNLAESTVYGVGS
NQRE_PSEA7      FLGLLSYIGVIAAIVQILEMLLDKYVPSLYNALGVFLPLITVNCAIMAGSLFMVERDYNLAESTVYGVGS
NQRE_DESAD      FVGLISYIGVIAAIVQILEMTLDKYVPSLYNALGIFLPLITVNCAILGASLFMVERDYNFVESVTFGFGS
NQRE_RHOBA      FLGFISYIGVIAAMVQILEMFLDRFMPSLYNALGIFLPLITVNCAILGASLFMEQREYPFGESVVFGFGC
NQRE_TOLAT      FLGFITYIGVIAALVQILEMFLDRYVPSLYSALGIFLPLITVNCAIFGGVSFMVQREYNFPESVVYGVGS
NQRE_CHLTB      FLELIMFIVVIAAFTQILELLLERFSRNLYLALGIFLPLIAVNCAILGGVLFGITRNYPFLPMVVFSLGS
NQRE_CHLT2      FLELIMFIVVIAAFTQILELLLERFSRNLYLALGIFLPLIAVNCAILGGVLFGITRNYPFLPMVVFSLGS
NQRE_CHLTR      FLELIMFIVVIAAFTQILEVLLERFSRNLYLALGIFLPLIAVNCAILGGVLFGITRNYPFLPMVVFSLGS
NQRE_CHLTA      FLELIMFIVVIAAFTQILEVLLERFSRNLYLALGIFLPLIAVNCAILGGVLFGITRNYPFLPMVVFSLGS
NQRE_YERPP      FLNFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVNCAIFGGVSFMAQRDYNFPESIVYGFGS
NQRE_YERPN      FLNFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVNCAIFGGVSFMAQRDYNFPESIVYGFGS
NQRE_NITEU      FLGLVSYLGVIAAIVQILEMFLDRFMPALHSALGIYLPLIAVNCAILGGSLFMVERDYNFTESLVYGLGS
NQRE_PSYIN      FLGFITFIGVIAALVQILEMVLDKYFPALYQALGIYLPLITVNCAILGGVLFMVQREYNLMESLVYGVGS
NQRE_YERPE      FLDFITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIHCAIFGATIFMVQREYTFTESFVYGTGC
NQRE_CHLMU      FLELITFIVVIAAFTQILELLLERFSRNLYLALGIFLPLIAVNCAILGGVLFGITRNYPFLPMVVFSLGS
NQRE_DICNV      FLGLIAYIGVIAAVVQILEMFLDKYVPALYSALGIFLPLITVNCAILAGSLFMVERNYTFQESMVYGVGS
NQRE_CHLCV      FLELIIFIVVIAAFTQILELLLEKVSRNLYLSLGIFLPLIAVNCAILGGVLFGITRNYPFIPMMIFSLGA
NQRE_PSYWF      FLGLLSYIALIAATVQILEMFLDKFVPSLYNALGVFLPLITVNCAIMGGVLFMVERDYNFTESLTYGVXX
NQRE_PSEHT      FLRFLTFIGVIAALVQILEMALDKFFPALYNALGIFLPLITVNCAIFGAVSFMVERNYNFGESVVYGIGA
NQRE_PASMU      FLNFITFIGVIAALVQILEMVLDKYFPALYNALGIFLPLITVNCAIFGGVSFMVQRDYTFVESVVYGIGA
NQRE_VIBSL      FLNFIAFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVTRDYNFAESVVYGFGS
NQRE_ACTPJ      FLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNCAIFGGVSFMVQREYNFTESVVYGLGA
NQRE_ACTP2      FLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNCAIFGGVSFMVQREYNFTESVVYGLGA
NQRE_VIBFM      FLSFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESVVYGFGS
NQRE_VIBF1      FLSFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESVVYGFGS
NQRE_HAEPS      FLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNCAIFGAVSFMVQREYNFAESVVYGIGA
NQRE_IDILO      FLKFLTFIGVIAAIVQILEMALDKYVPALYNALGIFLPLITVNCAIFGGVAFMVERDYNFGESVVFGIGS
NQRE_CHRSD      FLGLLSYIGVIAALVQILEMFLDKFVPALYNALGVFLPLITVNCAILGASLFMVERSYDFGESVIYGAGA
NQRE_CHLPN      FLELIIFIVVIAAFTQILELLLEKVSRNLYLSLGIFLPLIAVNCAILGGVLFGITRSYPFIPMMIFSLGA
NQRE_PSEMY      FLGLLTFIGVIAALVQILEMTLDKYVPSLYNALGVFLPLITVNCAIMGGSLFMVERDYNLAESTVYGIGA
NQRE_ALISL      FLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFTESIVYGFGS
NQRE_ACTSZ      FLNFITFIGVIAALVQILEMFLDKFVPSLYSALGIFLPLITVNCAIFGGVSFMVQREYNFTESVVYGIGA
NQRE_TERTT      FLGLITYIGVIAALVQIMEMFLDRYVPALYNALGVFLPLITVNCAIMGGSLFMVERDYNFAESVVFGTGS
NQRE_ALTMD      FLNFLTFIGVIAALVQILEMSLDKFFPALYNALGIFLPLITVNCAIFGGVAFAVQREYNLTESVVYGVGS
NQRE_PSYCK      FLGLLSYIGLIAATVQILEMFLDKFVPSLYNALGVFLPLITVNCAILGGVLFMVERDYNFGESVVYGVGA
NQRE_PSYA2      FLGLLSYIGLIAATVQILEMFLDKFVPSLYNALGVFLPLITVNCAILGGVLFMVERDYNFGESVVYGVGA
NQRE_VIBVY      FLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESVVYGFGA
NQRE_VIBVU      FLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESVVYGFGA
NQRE_VIBPA      FLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESVVYGFGS
NQRE_VIBHB      FLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESIVYGFGS
NQRE_VIBAL      FLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNCAIFGGVSFMVQRDYNFAESIVYGFGS
NQRE_KLEP7      FLNFITFIGVIAALVQILEMILDKYFPALYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGS
NQRE_HAEDU      FLNFITFIGVIAALVQILEMILDKFFPALYSALGIFLPLITVNCAIFGGVSFMVQREYDLVESVVYGIGA
NQRE_MARAV      FLGLLTYIGVIAAIVQIMEMVLDKYIPALYAALGVFLPLITVNCAILGASLFMVERDYTFGESLVYGFXX
NQRE_COLP3      FLSFITFIGVIAALVQILEMLLDKYFPALYQALGIFLPLITVNCAIFGAVSFMVAKNLTLGESVVYGVGS
NQRE_HAHCH      FLGLLTYIGVIAAIVQILEMVLDKFFPALYNALGVFLPLITVNCAIMGASLFMVERDYTFGESLVYXXXX
NQRE_ALCBS      FLGLLSYIGVIAAIVQILEMTLDKYVPSLYNALGIFLPLITVNCAIMGASLFMVERDYTFGESXXXXXXX
NQRE_SACD2      FLGLICYIGVIAAIVQIMEMVLDKYFPALYGALGVFLPLITVNCAILGAALLMVQREYTXXXXXXXXXXX
RNFE_CELJU      -----AFVMIIASAVTCTELLMKAFTYELYQILGLFIPLIVTNCAVLGRADAFAS-KNKLIPSAVDGFMM
RNFE_RHOCA      --RIPAFILIIAAIVTVVDLALNAWLHDLHKVLGLFIALIVTNCAILGRAEAFAS-RFGVLASALDGLMM
RNFE_ALISL      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS-KNDPLPAALDGLWM
RNFE_PASMU      ------YVMIIATTVTVVQLLMNAYTYSLYQSLGIFIPLIVTNCIVIGRA--EAFASKNPLSHAMFGFAM
RNFE_HAEIN      --RIPIYVMIIATTVTAVQLLMNAYTYTLYQSLGIFIPLIVTNCIIIGRAEAFAS-KNSLLHSIWDGFSM
RNFE_HAEIG      --RIPIYVMIIATTVTAVQLLMNAYTYTLYQSLGIFIPLIVTNCIIIGRAEAFAS-KNSLLHSIWDGFSM
RNFE_HAEI8      --RIPIYVMIIATTVTAVQLLMNAYTYTLYQSLGIFIPLIVTNCIIIGRAEAFAS-KNSLLHSIWDGFSM
RNFE_VIBVY      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAYAS-KNDPLPAALDGFWM
RNFE_VIBVU      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAYAS-KNDPLPAALDGFWM
RNFE_VIBFM      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRA-ESFASKNDPLPAVLDGLWM
RNFE_VIBF1      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRA-ESFASKNDPLPAVLDGLWM
RNFE_MARAV      -----AFVMIIASFVTCAELLMQAFTYELYQILGIFIPLIVTNCAILGRADAFASKNPP-LPAILDGAMM
RNFE_VIBCM      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS-KNDVLPAALDGFWM
RNFE_VIBCH      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS-KNDVLPAALDGFWM
RNFE_VIBC3      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS-KNDVLPAALDGFWM
RNFE_HAEIE      --RIPIYVMIIATTVTAVQLLMNAYTYTLYQSLGIFIPLIVTNCIIIGRAEAFAS-KNSLLHSIWDGFSM
RNFE_VIBPA      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAYAS-KNDVLPAALDGLWM
RNFE_AZOVD      --RNPVMIGVIAGVVTLTDMAMNAWMHELYKVLGLFIALIVTNCAVLGRA-ESFCLRNPVIPSILDGAGM
RNFE_BUCAP      --RIPIYMIIVSSTVTCIEMLLHAYQFNLYQSLGVFIPLIVTNCIVVGRADC-IAYKSSFVISFLDGMSI
RNFE_SHEDO      --RIPVFVMIIAALVTSVQLLINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFAS-RNNLAHSAFDGLMM
RNFE_MAGSA      --RIPVYILIVAANVTFVDLGMNAWMHELYKVLGLFIPLIVSNCLPL-ARLEAFAAKEPVLPSFLDGLFM
RNFE_PSEST      --RNPLMIGIIAGVVTLIDMAINAWMHELYKVLGLFIALIVTNCAVLGRA-ESFCSRNPVLPSILDGRRA
RNFE_SHESW      --RIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCIIIG-XXXXXXXXXXXXXXXFDGLMM
RNFE_SHEPC      --RIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCIIIG-XXXXXXXXXXXXXXXFDGLMM
RNFE_PSEAE      -----AFVMIIAVLTTCIELLMQAWTYELYQVLGIFIPLITTNCVILGRA--------------------
RNFE_PSEA8      -----AFVMIIAVLTTCIELLMQAWTYELYQVLGIFIPLITTNCVILGRA--------------------
RNFE_VIBSL      --RIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS-KNEVLPAAQDGFWM
RNFE_SHELP      -IRIPVFVMIIAALVTCVQLLINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFAS-RNSVVKAAFDGLMM
RNFE_HAEDU      -IRIPIYVMVIATVVTAVQLLMNAFAYPVYQSLGIFIPLIVTNCIVIGRAEAYAS-KHQVHHSAFDGLAT
RNFE_PSEAB      -----AFVMIIAALTTCIELLMQAWTYELYQVLGIFIPLITTNCVILGRA--------------------
NQRD_PSEA6      VQMTIIASLVIVV-----DQILKAYSYEISKQLSVFVGLIITNCIVMGRAEAFAMKSPPFI-SFLDGIGN
NQRD_ALTMD      IQMTIIASLVIVV-----DQILKAYSYEISKQLSVFVGLIITNCIVMGRAEA-YAMKSPPLMSFLDGIGN
RNFE_SHEPA      -IRIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFAS-RNSVAKSAFDGLMM
RNFE_ERWT9      -IRIPIYVMIIAAVVSCVQMLINAYAYGLYQSLGIFIPLIVTNCIVVGRAEA-VASKSSVPLSALDGMAI
RNFE_SHEAM      -IRIPVFVMIIAALVTVVQLVINAYAYGLYLSLGIFLPLIVTNCVIIGRA--EAFASRNSVGAAAFGLMM
RNFE_SHEPW      YIRIPVFVMIIAALVTSVQLFINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFAS-RNSVVKSTFDGLMM
RNFE_SHEB9      --RIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCIIIG----------------------
RNFE_SHEB8      --RIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCIIIG----------------------
RNFE_SHEB2      --RIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCIIIG----------------------
RNFE_ENTS8      -IRIPIYVMIIAAVVSIVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEA-FAAKNGPLLSALDGFAI
RNFE_THISH      -IRIPVFVLIIASVVTAIELAMNAFFHELYLILGIFIPLIVTNCAIIGRA--EAFASKQPIPKALAGLAM
RNFE_KLEP3      -IRIPIYVMIIASVVSVVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_BUCBP      --RXXXXXXXXXXXXXXXXXXXKAYAFNLYQSLGIFIPLIITNCIVCNRADL-IAVHNSVLVSILDGLSI
RNFE_SALTY      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALTI      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALSV      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALPK      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALPC      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALPB      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALPA      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALNS      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALHS      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALG2      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALEP      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALDC      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALCH      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALAR      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_SALA4      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPWL-SALDGFSI
RNFE_HAEPS      -IRIPIYVMIIATAVTTIQLLMNAFAFPVYQSLGIFVPLIVTNCIVIGRAEAFAS-KNSVAHSAFDGFAM
NQRD_PASMU      --RIIVQMAIIASLVILVDQILRAYAYGLSKQLSVFVGLIITNCIVMGRAEA-FAMKSQPLESFVDGIGN
RNFE_YERPY      -IRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGL-SALDGFAM
RNFE_YERPP      -IRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGL-SALDGFAM
RNFE_YERPN      -IRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGL-SALDGFAM
RNFE_YERPG      -IRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGL-SALDGFAM
RNFE_YERPE      -IRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGL-SALDGFAM
RNFE_YERPB      -IRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGL-SALDGFAM
RNFE_YERPA      -IRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGL-SALDGFAM
RNFE_YERP3      -IRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAAKNPVGL-SALDGFAM
RNFE_SHISS      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_SHIDS      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_SHIBS      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_SHIB3      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOUT      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOSM      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOSE      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOLU      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOLI      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOLC      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOL6      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOL5      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOK1      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOHS      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECODH      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECOBW      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECO8A      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECO81      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECO7I      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECO5E      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECO57      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECO55      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECO45      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECO27      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_ECO24      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_SHIF8      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
NQRD_TOLAT      VQMTIIASLVIVV-----DQLLKAFSYELSKQLSVFVGLIITNCIVMGRAEAYAMKSPPWL-SFLDGIGN
NQRD_NEIMF      --RIIVQMAIIASLVTLVDQLLQAFAYELSKQLSVFVGLIITNCIVMGRAEA-FAMKEPPLESLIDGIGN
NQRD_NEIMB      --RIIVQMAIIASLVTLVDQLLQAFAYELSKQLSVFVGLIITNCIVMGRAEA-FAMKEPPLESLIDGIGN
NQRD_NEIMA      --RIIVQMAIIASLVTLVDQLLQAFAYELSKQLSVFVGLIITNCIVMGRAEA-FAMKEPPLESLIDGIGN
NQRD_NEIM0      --RIIVQMAIIASLVTLVDQLLQAFAYELSKQLSVFVGLIITNCIVMGRAEA-FAMKEPPLESLIDGIGN
NQRD_NEIG1      --RIIVQMAIIASLVTLVDQLLQAFAYELSKQLSVFVGLIITNCIVMGRAEA-FAMKEPPLESLIDGIGN
NQRD_HAEIN      IIVQLAIIASLVIVV---DQILKAYAYGLSKQLSVFVGLIITNCIVMGRAEA-FAMKSPPVESFVDGIGN
NQRD_HAEIG      IIVQLAIIASLVIVV---DQILKAYAYGLSKQLSVFVGLIITNCIVMGRAEA-FAMKSPPVESFVDGIGN
NQRD_HAEIE      IIVQLAIIASLVIVV---DQILKAYAYGLSKQLSVFVGLIITNCIVMGRAEA-FAMKSPPVESFVDGIGN
NQRD_HAEI8      IIVQLAIIASLVIVV---DQILKAYAYGLSKQLSVFVGLIITNCIVMGRAEA-FAMKSPPVESFVDGIGN
RNFE_ESCF3      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFAI
RNFE_CITK8      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAAKKGPAL-SALDGFSI
RNFE_PSEA7      -IRLPAFVMIIAALTTCIELLMQAWTYELYQILGIFIPLITTNCVILGRA--------------------
RNFE_SHESR      YIRIPVFVMIIAALVTAVQLLINAYAYGLYLSLGIFLPLIVTNCIIIG-XXXXXXXXXXXXXXXFDGLMM
RNFE_SHESM      YIRIPVFVMIIAALVTAVQLLINAYAYGLYLSLGIFLPLIVTNCIIIG-XXXXXXXXXXXXXXXFDGLMM
RNFE_SHESA      YIRIPVFVMIIAALVTAVQLLINAYAYGLYLSLGIFLPLIVTNCIIIG-XXXXXXXXXXXXXXXFDGLMM
NQRD_VIBPA      VQMAIIASLVIVV-----DQVLKAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSAPVPSLIDGIGN
NQRD_VIBHB      VQMAIIASLVIVV-----DQVLKAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSAPVPSLIDGIGN
NQRD_VIBAL      VQMAIIASLVIVV-----DQVLKAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSAPVPSLIDGIGN
RNFE_BUCAT      -LRIPIYMMIISSVVTSIEMLLHAYTFNLYQSLGIFIPLIVTNCIIVGRADL-IAYKSSIVESFFDGIFI
RNFE_BUCAI      -LRIPIYMMIISSVVTSIEMLLHAYTFNLYQSLGIFIPLIVTNCIIVGRADL-IAYKSSIVESFFDGIFI
RNFE_BUCA5      -LRIPIYMMIISSVVTSIEMLLHAYTFNLYQSLGIFIPLIVTNCIIVGRADL-IAYKSSIVESFFDGIFI
NQRD_VIBVU      VQMAIIASLVIVV-----DQILKAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSAPVPSLIDGIGN
NQRD_VIBFM      VQMAIIASLVIVV-----DQVLKAYLYDISKQLSVFVSLIITNCIVMGRAEAFAMKSAPF-PSFIDGIGN
NQRD_VIBF1      VQMAIIASLVIVV-----DQVLKAYLYDISKQLSVFVSLIITNCIVMGRAEAFAMKSAPF-PSFIDGIGN
NQRD_SHEFN      VQMTIIASLVIVV-----DQVLQAYAYAISKQLSVFVGLIITNCIVMGRAEA-YAMKTPPMMSFMDGIGN
NQRD_HAEDU      --RIIVQMAIIASLVILVDQILRAYVYDLSKQLSVFVGLIITNCIVMGRAEA-FAMKSAPLESFVDGIGN
NQRD_PHOPR      VQMAIIASLVIVV-----DQVLKAFVYDISKQLSVFVGLIITNCIVMGRAEA-YAMKSAPLPSFIDGVGN
NQRD_AERS4      --RIIAQMAVIASLVIVVDQVLKAYAYEISKQLSVFVGLIITNCIVMGRAEA-YAMKSAPLPSFLDGIGN
NQRD_AERHH      --RIIAQMAVIASLVIVVDQVLKAYAYDISKQLSVFVGLIITNCIVMGRAEA-YAMKSAPLPSFLDGIGN
NQRD_YERPY      --RIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_YERPS      --RIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_YERPP      --RIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_YERPN      --RIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_YERPG      --RIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_YERPE      --RIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_YERPB      --RIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_YERPA      --RIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_YERP3      --RIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_VIBVY      VQMAIIASLVIVV-----DQILKAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSAPVPSLIDGIGN
NQRD_SHEPW      VQMTIIASLVIVV-----DQVLQAYAYDVAKQLSVFVGLIITNCIVMGRAEA-FAMKTPPMMSFMDGLGN
NQRD_PSEHT      VQMTIIASLVIVV-----DQVLQAFSYATAKELSVFIGLIITNCIVMGRAEA-YAMKSPPLMSFLDGIGN
RNFE_SHEFN      -IRIPVFVMIIAALVTCVQXXXXXXXXXXXXXXGIFLPLIVTNCVIIGRAEAFAS-RNSLAHSAFDGLMM
NQRD_YERE8      --RIIVQMVIIASLVIVVDQILRAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_VIBCM      VQMAIIASLVIVV-----DQILKAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSEPIPSFIDGIGN
NQRD_VIBCH      VQMAIIASLVIVV-----DQILKAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSEPIPSFIDGIGN
NQRD_VIBC3      VQMAIIASLVIVV-----DQILKAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSEPIPSFIDGIGN
NQRD_SHEPA      VQMTIIASLVIVV-----DQVLQAYAYDVAKQLSVFVGLIITNCIVMGRAEA-YAMKTPPMMSFMDGIGN
NQRD_SHEDO      VQMTIIASLVIVV-----DQVLQAYAYEIAKQLSVFVGLIITNCIVMGRA--------------------
RNFE_PSEA6      -IRIPIFVMIIAAFVTVVQLLMNAYTYELYQALGIFIPLIVTNCAIIGRA--------------------
NQRD_VIBSL      VQMAIIASLVIVV-----DQVLKAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSAPIPSFIDGLGN
NQRD_VIBAN      VQMAIIASLVIVV-----DQILRAYLYDISKQLSVFVGLIITNCIVMGRAEA-FAMKSAPIPSFIDGIGN
NQRD_CHLFF      MITQLIIISLFVIVIQFLKAFFFNIS----KTLSVFVGLIITNCIVMGRA---ESLARNVIPAFLDGLAS
RNFE_SHEON      YIRIPVFVMIIAALVTAVQLLVNAYAYGLYMSLGIFLPLIVTNCIIIG----------------------
NQRD_SHELP      VQMTIIASLVIVV-----DQVLQAYAYDVAKQLSVFVGLIITNCIVMGRAEA-YAMKTPPMMSFMDGIGN
NQRD_PSEA7      --RMIVQMVIIASLVIVVDQVLKAYAYSLSKQLSVFVGLIITNCIVMGRAEA-FAMANPPLVSFFDGIGN
RNFE_SODGM      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRA--------------------
RNFE_EDWI9      -IRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRA--------------------
NQRD_PSEAE      --RMIVQMVIIASLVIVVDQVLKAYAYSLSKQLSVFVGLIITNCIVMGRAEA-FAMANPPLVSFFDGIGN
NQRD_PSEAB      --RMIVQMVIIASLVIVVDQVLKAYAYSLSKQLSVFVGLIITNCIVMGRAEA-FAMANPPLVSFFDGIGN
NQRD_PSEA8      --RMIVQMVIIASLVIVVDQVLKAYAYSLSKQLSVFVGLIITNCIVMGRAEA-FAMANPPLVSFFDGIGN
NQRD_SHEHH      VQMTIIASLVIVV-----DQVLQAYAYDVAKQLSVFVGLIITNCIVMGRAEA-YAMKTPPMMSFMDGIGN
NQRD_CHLCV      SVRMITQLIIISLFVIVIDQFLKAFFFTISKTLSVFVGLIITNCIVMGRA---ESLARNVIPAFLDGLAS
NQRD_SHESH      VQMTVIASLVIVV-----DQVLQAYAYDVAKQLSVFVGLIITNCIVMGRAEA-YAMKTPPMMSFMDGIGN
NQRD_PROMH      VQMAIIASLVIVV-----DQVLQAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_PHOLL      VQMAIIASLVIVV-----DQILQAYAYEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_SHEWM      VQMTIIASLVIVV-----DQVLQAYAYDVAKQLSVFVGLIITNCIVMGRAEA-YAMKTPPMMSFMDGIGN
NQRD_SERP5      VQMAIIASLVIVV-----DQLLRAYAFEISKQLSVFVGLIITNCIVMGRA--------------------
NQRD_CHLPN      -TQLIIISLFVIVIDQFLKAFFFDIS----KTLSVFVGLIITNCIVMG---RSESLARHVIPAFLDGFAS
NQRD_CHLMU      --RMIAQLIIISLFVILIDQFLKAFFFNISKTLSVFVGLIITNCIVMGRA-ESMARHISPIPAFLDGLGS
NQRD_CHLAB      SVRMITQLIIISLFVIVIDQFLKAFFFDISKTLSVFVGLIITNCIVMGRA---ESLARNVIPAFLDGFAS
NQRD_PSYIN      VQMAIIASLVIVV-----DQFLRAYAFSISKQLSVYVGLIITNCIVMGRA--------------------
Y576_METJA      YFNVLLFIFLVPWVLRWIMFKDNALADLKHPVLSAFYPTIAVSCLVLGADF--INIGHNMFWGGVFWTLG
NQRD_CHLTR      --RMIAQLIIISLFVILIDQFLKAFFFTISKTLSVFVGLIITNCIVMGRA-ESMARHVSPIPAFLDGLGS
NQRD_CHLTB      --RMIAQLIIISLFVILIDQFLKAFFFTISKTLSVFVGLIITNCIVMGRA-ESMARHVSPIPAFLDGLGS
NQRD_CHLTA      --RMIAQLIIISLFVILIDQFLKAFFFTISKTLSVFVGLIITNCIVMGRA-ESMARHVSPIPAFLDGLGS
NQRD_CHLT2      --RMIAQLIIISLFVILIDQFLKAFFFTISKTLSVFVGLIITNCIVMGRA-ESMARHVSPIPAFLDGLGS


                         +         .         .         .         .         *         .:210
query           AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SHIDS      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SHIB3      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOSM      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOSE      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOLU      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOLI      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOLC      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOL6      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOL5      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOHS      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECODH      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOBW      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECO8A      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECO81      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECO7I      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECO5E      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECO57      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECO55      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECO27      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECO24      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOUT      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECOK1      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ECO45      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SHISS      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFNGLVKL
RNFA_SHIFL      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SHIF8      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SHIBS      AVGFSLVMVLFTAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_ESCF3      AVGFSLVMVLFAAIRERLAVANVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_CITK8      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALTY      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALTI      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALSV      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALPK      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALPC      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALPB      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALPA      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALNS      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALHS      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALG2      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALEP      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALDC      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALCH      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALA4      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_SALAR      AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_KLEP3      AVGFSLVMVLFAAIRERLVVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
RNFA_YERPY      AAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_YERPN      AAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_YERPG      AAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_YERPE      AAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_YERPB      AAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_YERPA      AAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_YERP3      AAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_YERE8      AAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_YERPP      AAGFSLVMVLFAAIRERLAVADVPAPFRRSSIALITAGLMSLAFMGFTGLVK-
RNFA_PHOLL      AAGFSLVMVLFAAIRERLAVADVPAPFKGSSIGLITAGLMSLAFMGFSGLVK-
RNFA_SODGM      AVGFSLVMVLFAAIRERLAVADVPAPFKGSSIALITAGLMSLAFMGFTGLVKV
RNFA_PROMH      AVGFSLVMVLFAAIRERLAVANIPAPFKGSSIGLITAGLMSLAFMGFSGLVKL
RNFA_ENTS8      AVGFSLVMVLFAAIRERLVVADVPLPFRGNAIALVTAGLMSLAFMGFSGLVK-
RNFA_ERWT9      SIGFSLVMVLFAGVRERLVLADVPAPFKGSSIALVTAGLMALAFMGFAGLVK-
RNFA_EDWI9      AVGFSLVMVLFAAIRERLALADVPAPFRGASIALITAGLMSLAFMGFSGLVK-
RNFA_VIBCH      AVGFSLVLILFASMRERIHVADVPAPFKGASIAMITAGLMSLAFMGFTGLVKL
RNFA_VIBHB      AVGFSLVLILFASMRERIAAADVPVPFRGASIAMITAGLMSLAFMGFTGLVK-
RNFA_AERHH      ATGFSLVLILFAAMRERLVAADVPTPFRGVSIAMITAGLMSLAFMGFTGLIKI
RNFA_ERWCT      AAGFSLVMVLFAAIRERLAVSDIPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_SERP5      AAGFSLVMVLFAAIRERLAVADVPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_ALISL      AVGFSLVLILFSAMRERIAAADVPLPFKGASIAMITAGLMSLAFMGFTGLVKL
RNFA_VIBVY      AVGFSLVLILFASMRERISAADVPAPFKGASIAMITAGLMSLAFMGFTGLVK-
RNFA_VIBVU      AVGFSLVLILFASMRERISAADVPAPFKGASIAMITAGLMSLAFMGFTGLVK-
RNFA_VIBF1      AVGFSLVLILFSAMRERIAAADVPLPFKGASIAMITAGLMSLAFMGFTGLVKL
RNFA_PECCP      AAGFSLVMVLFAAIRERLAVSDIPAPFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_AERS4      AAGFSLVLILFAAMRERLVAADVPTPFRGVSIAMVTAGLMSLAFMGFTGLIKI
RNFA_PSEA6      AVGFSLVLILFAAMRERLAVADVPAPFKGASISMITAGLMSLAFLGFTGLVK-
RNFA_HAES2      SLGFSLVLVLFAALRERLTAADIPLPFRGASIALITAGLMSLAFMGFSGLVRV
RNFA_HAES1      SLGFSLVLVLFAALRERLTAADIPLPFRGASIALITAGLMSLAFMGFSGLVRV
RNFA_VIBSL      AVGFSLVLILFAAMRERIAVADVPMPFKGASIAMITAGLMSLAFMGFTGLVK-
RNFA_VIBPA      AVGFSLVLILFASMRERIAAADVPVPFKGASIAMITAGLMSLAFMGFTGLVK-
RNFA_THISH      AVGFSLVLVLFASIRERVAVADVPLPFKGNAIALITAGLMSLGFMGFIGLVK-
RNFA_MARAV      AAGFSLVLVLFAAMRERIAVSDVPVAFRGAAIGMITAGLMSLAFLGFTGLV--
RNFA_SHEPC      AVGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHESW      ALGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHEB9      ALGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHEB8      ALGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHESR      AVGFSLVLILFSAMRERLAAADVPMPFKGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHESM      AVGFSLVLILFSAMRERLAAADVPMPFKGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHESA      AVGFSLVLILFSAMRERLAAADVPMPFKGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHEON      AVGFSLVLILFSAMRERLAAADVPEPFKGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHESH      AVGFSLVLILFSAMRERLAAADVPLPFRGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHEAM      AVGFSLVLILFSAMRERLAAADVPMPFRGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHEPA      AVGFSLVLILFSAMRERLAAADVPTPFKGGAIAMVTAGLMSLAFMGFTGLVK-
RNFA_SHEB2      ALGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLMSLAFMGFTGLVK-
RNFA_SHEDO      AVGFSMVLILFSAMRERLAAADVPLPFRGGAIAMITAGLMSLAFMGFAGLIK-
RNFA_HAHCH      AVGFSLVLTLFSAMRERIAAADVPEPFKGGAIGMITAGLMSLAFLGFTGLVNI
RNFA_SHELP      AVGFSIVLILFSAMRERLAAADVPAPFKGGAIAMITAGLMSLAFMGFTGLV--
RNFA_SHEPW      AVGFSLVLILFSAMRERLAAADVPAPFKGGAIAMVTAGLMSLAFMGFTGLVK-
RNFA_PSEHT      AVGFSXXXXXXXXXXXXXXXXDVPTPFKGASIALITAGLMSMAFMGFTGLVK-
RNFA_PSEAE      GLGFSLVLVLFAALRERIAIADVPAPFRGAAIGMITAGLMSLAFMGFSGLVR-
RNFA_PSEAB      GLGFSLVLVLFAALRERIAIADVPAPFRGAAIGMITAGLMSLAFMGFSGLVR-
RNFA_PSEA8      GLGFSLVLVLFAALRERIAIADVPAPFRGAAIGMITAGLMSLAFMGFSGLVR-
RNFA_PSEA7      GLGFSLVLVLFAALRERIAIADVPAPFRGAAIGMITAGLMSLAFMGFSGLIR-
RNFA_HAEIG      SLGFSLVLVLFAALRERLVAADIPATFRGSAIALITAGLMSLAFMGFTGLVK-
RNFA_HAEIE      SLGFSLVLVLFAALRERLVAADIPATFRGSAIALITAGLMSLAFMGFTGLVK-
RNFA_HAEI8      SLGFSLVLVLFAALRERLVAADIPATFRGSAIALITAGLMSLAFMGFTGLVK-
RNFA_HAEIN      SLGFSLVLVLFAALRERLVAADIPATFRGSSIALITAGLMSLAFMGFTGLVK-
RNFA_ALCBS      AIGFSLVLILFAAMRERIAVADVPEAFRGPSIGLITAGLMSLAFMGFSGLIKL
RNFA_PSEMY      GLGFSLVLVLFAAMRERIAIADVPKSFQGAAIGMITAGLMSLAFMGFAGLIKL
RNFA_PASMU      SLGFGXXXXXXXXXXXXXXXXDVPHVFKGASIALITAGLMSLAFMGFTGLVR-
RNFA_AZOSB      ALGFTMVMVLFAGLRERLALTSVPAAFSGAPISFITAGLLSLAFMGFAGL---
RNFA_ALHEH      AAGFSLVLVLFAALRERLEVADVPLPFRGASVALVTAGILSMGFMGFAGLVRL
RNFA_AZOVD      GLGFSLVLVLFAAMRERIAIADVPKPFKGAAIGLITAGLMSLAFMGFSGLIK-
RNFA_COLP3      ALGFSLVLIMFSAMREKLANADVPAPFKGTAIAMITAGLMSLAFLGFTGLVKI
RNFA_TOLAT      XXXXXXXXXXXASLRERLAAADVPAPFQGIAIGMVTAGLMSLAFLGFTGLIKL
RNFA_PSYIN      XXXXXXXXXXXXXMRERLAASDIPLPFKGGSIAMITAGLMSLAFMGFTGLIK-
RNFA_HAEPS      AAGFSLVLVLFSALRERLVAADVPRAFQGASIALITAGLMSLAFMGFTGLVKI
RNFA_HAEDU      AVGFSXXXXXXXXXXXXXXXXDVPRPFQGASIALITAGLMSLAFMGFTGLVKL
RNFA_PELCD      AVGFTLALVLFAGLRERLRLCPVPAAFRGTPIELIT-----------------
RNFA_AZOSE      ALGFTLVLLIFAGLRERXXXXXXXXXXXXXXXXXITISLLSLAFMGLSGLV--
RNFA_BUCAT      SLGFALVMIIFSCIRERIVLSDIPLPFQGAPXXXXXXXXXXXXFMGFKGLIKI
RNFA_BUCAI      SLGFALVMIIFSCIRERIVLSDIPLPFQGAPXXXXXXXXXXXXFMGFKGLIKI
RNFA_BUCA5      SLGFALVMIIFSCIRERIVLSDIPLPFQGAPXXXXXXXXXXXXFMGFKGLIKI
RNFA_ACTPJ      ALGFSXXXXXXXXXXXXXXXXDVPRPFQGASIALITAGLMSLAFMGFTGLVKI
RNFA_ACTP2      ALGFSXXXXXXXXXXXXXXXXDVPRPFQGASIALITAGLMSLAFMGFTGLVKI
RNFA_RHOS4      ASGFTLVLVIFAGMRERLAQLSVPGPFAGAPIAFISAGLLSMAFMGFAGL---
RNFA_RHOS1      ASGFTLVLVIFAGMRERLAQLSVPGPFAGAPIAFISAGLLSMAFMGFAGL---
RNFA_RHOCA      SVGFTLVLVIFAGMRERLAQLSVPAAFAGTPIAFVS-----------------
RNFA_BUCBP      SLGFFLVLVIFXXXXXXXXXXDVPMYFRGYPXXXXXXXXXXXXFMGFDGLIK-
RNFA_BUCAP      SFGFTLVMVIFSSIRERILLSDVPLAFQGSPXXXXXXXXXXXXFMGFKGLVRI
NQRE_METCA      GFGWALAITAMAGVREKLKYSDVPAGLRGLGITFISAGLMALGFMAFSGI---
NQRE_AERS4      GAGWMLAIVAMAGIREKMKYSDVPQGLRGLGITFITAGLMALGFMSFSGI---
NQRE_AERHH      GAGWMLAIVAMAGIREKMKYSDVPEGLRGLGITFITAGLMALGFMSFSGI---
NQRE_VIBAN      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITAGLMALGFMSFSGV---
NQRE_HAES1      GTGWMLAIVALAGITEKMKYADVPAGLRGLGITFITVGLMALGFMSFSGV---
NQRE_SERP5      GTGWMLAIVAMAGIREKLKYANVPAGLRGLGITFITTGLMALGFMSFSGV---
NQRE_PHOPR      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_HAES2      GTGWMLAIVALAGITEKMKYADVPAGLRGLGITFITVGLMALGFMSFSGV---
NQRE_PROMH      GIGWMLAIVLLASIREKMKYADVPSGMKGLGVTFVTTGLMALGFMSFSGV---
NQRE_NEIMF      GLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGI---
NQRE_NEIM0      GLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGI---
NQRE_HAEIG      GLGWMLAIVALAGLTEKMKYADIPAGLKGLGITFISVGLMALGFMSFSGI---
NQRE_HAEIE      GLGWMLAIVALAGLTEKMKYADIPAGLKGLGITFISVGLMALGFMSFSGI---
NQRE_HAEI8      GLGWMLAIVALAGLTEKMKYADIPAGLKGLGITFISVGLMALGFMSFSGI---
NQRE_YERE8      GIGWMLAIVALAGIREKMKYANVPAGLQGLGITFITTGLMALGFMSFSGV---
NQRE_PSEU5      GLSWALAIALLAGIREKLKYSDVPDGLQGLGITFITIGLMSLGFMSFSGV---
NQRE_SHEDO      GIGWALAIVLLAAVREKMKYSDVPNGLRGLGITFISAGLMALGFMSFSGV---
NQRE_PHOLL      GIGWMLAIVLLASIREKMKYADVPAGLKGLGITFVTTGLMALGFMSFSGV---
NQRE_NEIMB      GLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGI---
NQRE_AZOVD      GFSWALAIALLAGIREKLKYSDVPEGLQGLGIAFITIGLMSLGFMSFSGI---
NQRE_MANSM      GTGWMLAIVALAGLTEKMKYADVPAGLRGLGITFITVGLMALGFMSFSGI---
NQRE_NEIG2      GLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGI---
NQRE_NEIG1      GLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGI---
NQRE_NEIMA      GLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGI---
NQRE_HAEIN      GLGWMLAIVALAGLTEKMKYADIPAGLKGLGITFISVGLMALGFMSFSGI---
NQRE_VIBCM      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITAGLMALGFMSFSGV---
NQRE_VIBCH      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITAGLMALGFMSFSGV---
NQRE_VIBC3      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITAGLMALGFMSFSGV---
NQRE_PSEA6      GAGWALAITLLAAVREKLKYADMPEGVRGLGSVFMIAGLMALGFQSFSGV---
NQRE_CELJU      GAGWAIAIVLLAGILEKMKYSDIPEGLRGLGITFITVGLMSLGFMSFGGI---
NQRE_PSEAE      GFSWALAIAALAGIREKLKYSDVPEGLQGLGITFITIGLMSLGFMSFSGV---
NQRE_PSEAB      GFSWALAIAALAGIREKLKYSDVPEGLQGLGITFITIGLMSLGFMSFSGV---
NQRE_PSEA8      GFSWALAIAALAGIREKLKYSDVPEGLQGLGITFITIGLMSLGFMSFSGV---
NQRE_PSEA7      GFSWALAIAALAGIREKLKYSDVPEGLQGLGITFITIGLMSLGFMSFSGV---
NQRE_DESAD      GVGWALAIVLLAGIREKMKYSDVPEGLDGLGITFIVVGLMSFGFLSFSGI---
NQRE_RHOBA      GVGWALAIMALAGIREKLKYSDVPPPLRGLGITFITVGLMSLAFMSFSGI---
NQRE_TOLAT      GISWALAIVLMAAIREKMKYSDVPPGLRGLGITFITAGLMALGFMSFSGI---
NQRE_CHLTB      GCGWWLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGI---
NQRE_CHLT2      GCGWWLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGI---
NQRE_CHLTR      GCGWWLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGI---
NQRE_CHLTA      GCGWWLAIVLFATIREKLAYSDVPQHLRGTGISFITTGLMAMAFMGLTGI---
NQRE_YERPP      GMGWMLAIVALAGIREKMKYANVPAGLQGLGITFISTGLMALGFMSFAGV---
NQRE_YERPN      GMGWMLAIVALAGIREKMKYANVPAGLQGLGITFISTGLMALGFMSFAGV---
NQRE_NITEU      GFGWALAIVALAGVRERLKYSDVPDGLQGLGITFISAGLMAMGFMAFSGI---
NQRE_PSYIN      GVGWMLAIVLLAGIREKMKYSDVPAGLRGLGITFTTAGLMAIAFMSFSGI---
NQRE_YERPE      GLGWMLAIISMAGLREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGI---
NQRE_CHLMU      GCGWWLAIVLFATIREKLAYSDIPQHLQGMGISFITTGLIAMAFMGLTGI---
NQRE_DICNV      GVGWALAIAVMAGVREKMRYADVPKGLEGLGITFITAGLMAIGFMSFSGI---
NQRE_CHLCV      GCGWWLAIVLFATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGI---
NQRE_PSYWF      XXXXXXXXXXXXXIREKLKYSDVPAPLRGLGITFITVGLMSLGFMSFGGM---
NQRE_PSEHT      GVGWALAITLLAGIREKMKYSDVPDGLRGLGITFITVGLMALGFMSFSGI---
NQRE_PASMU      GTGWMLAIVALAGITEKMKYADVPAGLRGLGITFITVGLMALGFMSFSGI---
NQRE_VIBSL      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_ACTPJ      GTGWMLAIVALAGLTEKMKYSDVPAGLRGLGITFITVGLMALGFMSFSGI---
NQRE_ACTP2      GTGWMLAIVALAGLTEKMKYSDVPAGLRGLGITFITVGLMALGFMSFSGI---
NQRE_VIBFM      GIGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_VIBF1      GIGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_HAEPS      GTGWMLAIVALAGITEKMKYSDVPAGLKGLGITFISAGLMALGFMSFSGI---
NQRE_IDILO      GVGWALAIVALAAVREKLKYADVPDGLRGLGITFISVGLIGLGFMSFSGV---
NQRE_CHRSD      GVGWALAITALAGIREKLKYSDVPASLQGLGITFITVGLMSLGFMSFSGI---
NQRE_CHLPN      GCGWWLAIVILATIKEKLAYSDIPKNLQGMGISFITTGLIAMAFMSLTGI---
NQRE_PSEMY      GVSWALAIAALAGIREKLKYSDVPAGLQGLGITFITIGLMSLGFMSFSGV---
NQRE_ALISL      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_ACTSZ      GTGWMLAIVALAGLTEKMKYADVPAGLRGLGITFITVGLMALGFMSFSGI---
NQRE_TERTT      GFGWALAITALAGIREKMKYSDVPEGLQGLGITFIVVGLMSLGFMSFGGI---
NQRE_ALTMD      GIGWAIAIVLLAAVREKLKYADMPDGVRGLGSVFMIAGLMALGFQSFTGI---
NQRE_PSYCK      GFGWALAITALAGIREKLKYSDIPAPLRGLGITFITVGLMSLGFMSFGGM---
NQRE_PSYA2      GFGWALAITALAGIREKLKYSDIPAPLRGLGITFITVGLMSLGFMSFGGM---
NQRE_VIBVY      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_VIBVU      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_VIBPA      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_VIBHB      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_VIBAL      GVGWMLAIVALAGIREKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGV---
NQRE_KLEP7      GIGWMLAIVAMAGIREKMKYANVPAGLRGLGITFI