[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ecol0:AAC75368.1

[Show Plain Result]


## Summary of Sequence Search
    1::228
    1::228     e-113 100%  228 aa  HISQ_ECOLI RecName: Full=Histidine transport system permease
    1::228     e-105  92%  228 aa  HISQ_SALTY RecName: Full=Histidine transport system permease
    1::228     e-105  92%  228 aa  HISQ_SALTI RecName: Full=Histidine transport system permease
   55::234     1e-32  39%  236 aa  NOCQ_AGRT5 RecName: Full=Nopaline transport system permease protein
   61::235     3e-32  38%  237 aa  OCCQ_RHIRD RecName: Full=Octopine transport system permease protein
   61::235     3e-32  38%  237 aa  OCCQ_AGRT4 RecName: Full=Octopine transport system permease protein
   40::214     7e-30  34%  221 aa  ARTQ_HAEIN RecName: Full=Arginine ABC transporter permease protein
   52::229     3e-29  38%  238 aa  ARTQ_SHIFL RecName: Full=Arginine ABC transporter permease protein
   52::229     3e-29  38%  238 aa  ARTQ_ECOLI RecName: Full=Arginine ABC transporter permease protein
   52::229     3e-29  38%  238 aa  ARTQ_ECOL6 RecName: Full=Arginine ABC transporter permease protein
   61::201     2e-25  37%  237 aa  OCCQ_RHIME RecName: Full=Octopine transport system permease protein
   45::219     1e-23  35%  241 aa  NOCM_AGRT5 RecName: Full=Nopaline transport system permease protein
   59::219     1e-18  32%  224 aa  YXEN_BACSU RecName: Full=Probable amino-acid permease protein yxeN;
   50::208     1e-18  35%  210 aa  Y1079_HAEIN RecName: Full=Probable amino-acid ABC transporter
   15::217     3e-18  25%  218 aa  GLNP_RICPR RecName: Full=Putative glutamine transport system
   58::218     8e-18  29%  219 aa  GLNP_SHIFL RecName: Full=Glutamine transport system permease
   58::218     8e-18  29%  219 aa  GLNP_ECOLI RecName: Full=Glutamine transport system permease
   58::218     8e-18  29%  219 aa  GLNP_ECOL6 RecName: Full=Glutamine transport system permease
   58::218     8e-18  29%  219 aa  GLNP_ECO57 RecName: Full=Glutamine transport system permease
   15::217     2e-17  25%  218 aa  GLNP_RICBR RecName: Full=Putative glutamine transport system
   62::200     4e-17  35%  238 aa  HISM_SHIFL RecName: Full=Histidine transport system permease
   62::200     4e-17  35%  238 aa  HISM_ECOLI RecName: Full=Histidine transport system permease
   62::200     4e-17  35%  238 aa  HISM_ECOL6 RecName: Full=Histidine transport system permease
   62::200     4e-17  35%  238 aa  HISM_ECO57 RecName: Full=Histidine transport system permease
   62::200     5e-17  35%  235 aa  HISM_SALTY RecName: Full=Histidine transport system permease
   62::200     5e-17  35%  235 aa  HISM_SALTI RecName: Full=Histidine transport system permease
   15::217     9e-17  24%  218 aa  GLNP_RICFE RecName: Full=Putative glutamine transport system
   15::217     9e-17  24%  218 aa  GLNP_RICCN RecName: Full=Putative glutamine transport system
   15::217     2e-16  23%  218 aa  GLNP_RICTY RecName: Full=Putative glutamine transport system
   58::220     3e-16  32%  245 aa  OCCM_RHIME RecName: Full=Octopine transport system permease protein
   68::192     7e-16  37%  238 aa  Y4TF_RHISN RecName: Full=Probable amino-acid ABC transporter
   67::227     7e-16  31%  234 aa  TCYB_BACSU RecName: Full=L-cystine transport system permease
   47::214     1e-15  29%  222 aa  ARTM_SHIFL RecName: Full=Arginine ABC transporter permease protein
   47::214     1e-15  29%  222 aa  ARTM_ECOLI RecName: Full=Arginine ABC transporter permease protein
   47::214     1e-15  29%  222 aa  ARTM_ECOL6 RecName: Full=Arginine ABC transporter permease protein
   47::214     1e-15  29%  222 aa  ARTM_ECO57 RecName: Full=Arginine ABC transporter permease protein
   47::233     2e-15  27%  235 aa  TCYM_BACSU RecName: Full=L-cystine transport system permease
   56::211     3e-15  28%  216 aa  GLNM_BACSU RecName: Full=Probable glutamine ABC transporter
   66::223     8e-15  27%  226 aa  YCKA_BACSU RecName: Full=Probable amino-acid ABC transporter
  295::428     2e-14  33%  434 aa  BZTC_RHOCA RecName: Full=Glutamate/glutamine/aspartate/asparagine
  214::384     3e-14  29%  384 aa  AAPM_RHIL3 RecName: Full=General L-amino acid transport system
   58::202     7e-14  29%  222 aa  YECS_SHIFL RecName: Full=Inner membrane amino-acid ABC transporter
   58::202     7e-14  29%  222 aa  YECS_ECOLI RecName: Full=Inner membrane amino-acid ABC transporter
   58::202     7e-14  29%  222 aa  YECS_ECOL6 RecName: Full=Inner membrane amino-acid ABC transporter
   54::214     7e-14  27%  219 aa  ARTQ_BACSU RecName: Full=Arginine transport system permease protein
   98::220     3e-13  26%  231 aa  Y4TG_RHISN RecName: Full=Probable amino-acid ABC transporter
   57::222     3e-13  24%  224 aa  GLTK_ECOLI RecName: Full=Glutamate/aspartate transport system
   57::222     3e-13  24%  224 aa  GLTK_ECOL6 RecName: Full=Glutamate/aspartate transport system
   57::222     3e-13  24%  224 aa  GLTK_ECO57 RecName: Full=Glutamate/aspartate transport system
   58::220     1e-12  37%  245 aa  OCCM_RHIRD RecName: Full=Octopine transport system permease protein
  203::363     1e-12  30%  367 aa  YHDY_ECOLI RecName: Full=Inner membrane amino-acid ABC transporter
   86::216     1e-12  26%  223 aa  PATM_VIBHA RecName: Full=Probable amino-acid ABC transporter
   68::239     1e-11  30%  246 aa  GLTJ_ECOLI RecName: Full=Glutamate/aspartate transport system
   68::239     1e-11  30%  246 aa  GLTJ_ECOL6 RecName: Full=Glutamate/aspartate transport system
   60::222     4e-11  25%  239 aa  TCYL_BACSU RecName: Full=L-cystine transport system permease
  218::385     1e-09  21%  400 aa  AAPQ_RHIL3 RecName: Full=General L-amino acid transport system
   52::182     5e-09  36%  227 aa  ARTM_HAEIN RecName: Full=Arginine ABC transporter permease protein
   51::208     7e-09  28%  228 aa  GLUC_COREF RecName: Full=Glutamate transport system permease
   55::187     9e-09  29%  228 aa  GLUC_CORGL RecName: Full=Glutamate transport system permease
  254::345     3e-08  27%  393 aa  YHDX_ECOLI RecName: Full=Putative amino-acid ABC transporter
   74::237     4e-07  25%  273 aa  GLUD_CORGL RecName: Full=Glutamate transport system permease
  101::212     4e-07  25%  218 aa  GLNP_BACSU RecName: Full=Probable glutamine ABC transporter
   70::191     3e-06  29%  277 aa  GLUD_COREF RecName: Full=Glutamate transport system permease
   58::148     6e-05  29%  217 aa  METI_YERPE RecName: Full=D-methionine transport system permease
   72::162     1e-04  34%  225 aa  METI_VIBCH RecName: Full=Probable D-methionine transport system
   62::148     1e-04  32%  217 aa  METI_SALTY RecName: Full=D-methionine transport system permease
   62::148     1e-04  32%  217 aa  METI_SALTI RecName: Full=D-methionine transport system permease
   62::148     2e-04  30%  217 aa  METI_ECOLI RecName: Full=D-methionine transport system permease
   62::148     2e-04  30%  217 aa  METI_ECO57 RecName: Full=D-methionine transport system permease
  153::218     8e-04  32%  301 aa  PSTA2_MYCTU RecName: Full=Phosphate transport system permease
  153::218     8e-04  32%  301 aa  PSTA2_MYCBO RecName: Full=Phosphate transport system permease
    1::228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLYGFSGVILQGALVTLEXXXXXXXXXXXXXXXXXXXXXXQNRLSGLIFEGYTTLIRGVPDLVLMLLIFY
HISQ_ECOLI      MLYGFSGVILQGALVTLEXXXXXXXXXXXXXXXXXXXXXXQNRLSGLIFEGYTTLIRGVPDLVLMLLIFY
HISQ_SALTY      MLYGFSGVILQGAIVTXXXXXXXXXXXXXXXXXXXXXXXSQNRVTGLIFEGYTTLIRGVPDLVLMLLIFY
HISQ_SALTI      MLYGFSGVILQGAIVTXXXXXXXXXXXXXXXXXXXXXXXSQNRVTGLIFEGYTTLIRGVPDLVLMLLIFY
NOCQ_AGRT5      ----------------------------------------------LLGDVYTTVVRGVPELLIIFLVFF
OCCQ_RHIRD      ---------------------------------------------------YTTALRGIPDLLVIYLFYF
OCCQ_AGRT4      ---------------------------------------------------YTTALRGIPDLLVIYLFYF
ARTQ_HAEIN      -----------------------------------------NRFVGKPMTVFVALLRGLPEIIVVLLVYF
ARTQ_SHIFL      -----------------------------------------------------TILRGLPEILVVLFIYF
ARTQ_ECOLI      -----------------------------------------------------TILRGLPEILVVLFIYF
ARTQ_ECOL6      -----------------------------------------------------TILRGLPEILVVLFIYF
OCCQ_RHIME      ---------------------------------------------------YTTALRGIPDLLVIYLFYX
NOCM_AGRT5      ----------------------------------------KNRIVSSLAYGYVYIIRSTPLLVQMFLIYY
YXEN_BACSU      ---------------------------------------------------YISFFRGVPTLVQLFLIYY
Y1079_HAEIN     ---------------------------------------------------YISIIRGTPMLVQIFIIFY
GLNP_RICPR      --------IIEGTLVTLKYSVIAVILGLVIGMLLAICKVNKNRVLRLFANFYTSIFRGTPLLVQLSIIYF
GLNP_SHIFL      ---------------------------------------------------FIEVIRGTPIVVQVMFIYF
GLNP_ECOLI      ---------------------------------------------------FIEVIRGTPIVVQVMFIYF
GLNP_ECOL6      ---------------------------------------------------FIEVIRGTPIVVQVMFIYF
GLNP_ECO57      ---------------------------------------------------FIEVIRGTPIVVQVMFIYF
GLNP_RICBR      --------IVEGTLITLKYSVIAVIFGLVIGVLLALCKVNKNRALRLFADFYTSIFRGTPLLIQLSIIYF
HISM_SHIFL      ---------------------------------------------------FTYIFRGTP-LYVQLLVFY
HISM_ECOLI      ---------------------------------------------------FTYIFRGTP-LYVQLLVFY
HISM_ECOL6      ---------------------------------------------------FTYIFRGTP-LYVQLLVFY
HISM_ECO57      ---------------------------------------------------FTYIFRGTP-LYVQLLVFY
HISM_SALTY      ---------------------------------------------------FTYIFRGTP-LYVQLLVFY
HISM_SALTI      ---------------------------------------------------FTYIFRGTP-LYVQLLVFY
GLNP_RICFE      --------IVEGTLVTLKYSVIAVIFGLVIGMLLAICKVNKNRALRLFANFYTSIFRGTPLLIQLSIIYF
GLNP_RICCN      --------IVEGTLVTLKYSVIAVIFGLVIGMLLAICKVNKNRALRLFANFYTSIFRGTPLLIQLSIIYF
GLNP_RICTY      --------IIEGTLVTLKYSIIAVILGLVIGMLLAICKVNKNCVLRLFANFYTSIFRGTPLLVQLSIIYF
OCCM_RHIME      ---------------------------------------------------YIFAFRGTPLLVQIYIIYY
Y4TF_RHISN      ---------------------------------------------------YIEIFRGTSLLVQLFWLFF
TCYB_BACSU      -----------------------------------------------VFSVYVSAIRGTPLLVQLFIIFY
ARTM_SHIFL      -----------------------------------------------LVRGYITLFTGTPLLVQIFLIYY
ARTM_ECOLI      -----------------------------------------------LVRGYITLFTGTPLLVQIFLIYY
ARTM_ECOL6      -----------------------------------------------LVRGYITLFTGTPLLVQIFLIYY
ARTM_ECO57      -----------------------------------------------LVRGYITLFTGTPLLVQIFLIYY
TCYM_BACSU      ------------------------------------------RIKGLVARFYVSFFRSTPAILHIMLIYL
GLNM_BACSU      ---------------------------------------------------YVEFIRNIPLLLITFVFYF
YCKA_BACSU      ---------------------------------------------------YISFMRGVPILVILFILYF
BZTC_RHOCA      ----------------------------------------------------------------------
AAPM_RHIL3      ---------------------------------------------------FIEVIRGVPLITVLFMASV
YECS_SHIFL      ---------------------------------------------------YISIFRGTPLIAQLFMIYY
YECS_ECOLI      ---------------------------------------------------YISIFRGTPLIAQLFMIYY
YECS_ECOL6      ---------------------------------------------------YISIFRGTPLIAQLFMIYY
ARTQ_BACSU      -----------------------------------------------IADFYTSVFRGTPLVLQLMIVYF
Y4TG_RHISN      ----------------------------------------------------------------------
GLTK_ECOLI      -------------------------------------------------KAYVNVFRSIP-LVMVLLWFY
GLTK_ECOL6      -------------------------------------------------KAYVNVFRSIP-LVMVLLWFY
GLTK_ECO57      -------------------------------------------------KAYVNVFRSIP-LVMVLLWFY
OCCM_RHIRD      ---------------------------------------------------YIFAFRGTPLLVQIYIIYY
YHDY_ECOLI      --------------------------------------------------------RGVPLITVLFMSSV
PATM_VIBHA      ----------------------------------------------------------------------
GLTJ_ECOLI      ---------------------------------------------------YVELFRNVP---LIVQFFT
GLTJ_ECOL6      ---------------------------------------------------YVELFRNVP---LIVQFFT
TCYL_BACSU      ---------------------------------------------------YISFFRGTPIMVQLFIVFY
AAPQ_RHIL3      --------------------------------------------TGQPFHTVWTAIALIVGLPLLVFVVS
ARTM_HAEIN      ---------------------------------------------------YLTLFTGTPLLVQFFLIYA
GLUC_COREF      -----------------------------------------------ISTAYINTVRNTPLTLVILFCSF
GLUC_CORGL      ---------------------------------------------------YINTVRNTPLTLVVLFCSF
YHDX_ECOLI      ----------------------------------------------------------------------
GLUD_CORGL      --------------------------------------------------------RAIPVLILMIFA-Y
GLNP_BACSU      ----------------------------------------------------------------------
GLUD_COREF      ---------------------------------------------GIIIETF----RAIPVLILMIFAYQ
METI_YERPE      --------------------------------------------------GVVNIFRSIPFIILLVWMIP
METI_VIBCH      --------------------------------------------------------RSVPFLVLMVAIIP
METI_SALTY      ------------------------------------------------------IFRSIPFIILLVWMIP
METI_SALTI      ------------------------------------------------------IFRSIPFIILLVWMIP
METI_ECOLI      ------------------------------------------------------IFRSIPFIILLVWMIP
METI_ECO57      ------------------------------------------------------IFRSIPFIILLVWMIP
PSTA2_MYCTU     ----------------------------------------------------------------------
PSTA2_MYCBO     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTRGQVFRR
HISQ_ECOLI      GLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTRGQVFRR
HISQ_SALTY      GLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTHGQTFRR
HISQ_SALTI      GLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTHGQTFRR
NOCQ_AGRT5      GGGTLLRTIANGLFGYEGYIEPFVIGVLCISVSAGAYATEVIRAAVLAVPPGQIEAAKSIGMGPWLRLRR
OCCQ_RHIRD      GSSSVISNVASLFGSGFVGASTFLIGALAIGVVSGAYQTQVLRGAVLALNKGEIEAGRAYGMGALLLFRR
OCCQ_AGRT4      GSSSVISNVASLFGSGFVGASTFLIGALAIGVVSGAYQTQVLRGAVLALNKGEIEAGRAYGMGALLLFRR
ARTQ_HAEIN      GS----TELVEMLTGEYIEFGAFGCGVLALSLIFAAYASQTLRGAIQAIPKGQWESGAALGLSKSYTFIH
ARTQ_SHIFL      GSSQLLLTLSDGMDIENFDVSPFLCGVIXXXXXXXXXXXQTLRGALKAVPVGQWESGQALGLSKSAIFFR
ARTQ_ECOLI      GSSQLLLTLSDGMDIENFDVSPFLCGVIXXXXXXXXXXXQTLRGALKAVPVGQWESGQALGLSKSAIFFR
ARTQ_ECOL6      GSSQLLLTLSDGMDIENFDVSPFLCGVIXXXXXXXXXXXQTLRGALKAVPVGQWESGQALGLSKSAIFFR
OCCQ_RHIME      XXXXXXXXXXXXXXXGFVSAPAFLTGALAIGLVSAAYQTQVLRGAVLALNKGEIEAGRAYGMGYFLLFRR
NOCM_AGRT5      G-SAQFRGVLSEVGLWSSFREPWFCAILALALNTAAYTSEIIRGGIQSVSLGQIEAARAVGMSTFLQFRR
YXEN_BACSU      GLPQLFPEMSK--------MTALTAAIIGLSLKNAAYLAEIFRAALNSVDDGQLEACLSVGMTKFQAYRR
Y1079_HAEIN     GLP----------EVG-ITLEPFPTAIIAFSINIGAYAAETVRASIIAIPKGQWEASYAIGMNYRQAFIR
GLNP_RICPR      AAPYIIN----------IKFNVFMAGVISFALNSGAYVSEVIRAGINTVDKGQFEAAEALAIPKFLIMKD
GLNP_SHIFL      ALPMAFN---------DLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRWETIRY
GLNP_ECOLI      ALPMAFN---------DLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRWETIRY
GLNP_ECOL6      ALPMAFN---------DLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRWETIRY
GLNP_ECO57      ALPMAFN---------DLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRWETIRY
GLNP_RICBR      ASPYLIG----------IKFTVFMAGAISFSLNSGAYVSEVIRAGINAVDKGQFEAAEALAIPKFLIMKD
HISM_SHIFL      SGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRC
HISM_ECOLI      SGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRC
HISM_ECOL6      SGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRC
HISM_ECO57      SGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSTFKMYRC
HISM_SALTY      SGMYTLEIVKGTDLLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRC
HISM_SALTI      SGMYTLEIVKGTDLLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRC
GLNP_RICFE      ASPYIIG----------VKFSVFMAGAISFSLNSGAYVSEVIRAGINAVDKGQFEAAVALAIPKFLIMKD
GLNP_RICCN      ASPYIIG----------IKFSVFMAGAIAFSLNSGAYVSEVIRAGINAVDKGQFEAAEALAIPKFLITKD
GLNP_RICTY      AAPYIIS----------IKFSVFMAGVISFALNSGAYVSEVIRAGINTIDKGQFEAAEALAIPKFLIMKD
OCCM_RHIME      GL-------SQFPGLRHSLLWPFLCALGALALNTAAYSAEIMRGGLLSVPAGQIEAARACGMARVLLFRR
Y4TF_RHISN      ALPIA----GDMMGI-DLRLSPVVAGVLALSLNLGAYGAEIVRGAIQAVSPSQYEAATALNFSSSQALWR
TCYB_BACSU      -LFPAFN----------VTLDPFPSAVIAFSLNVGAYASEIIRASILSVPKGQWEAGYTIGMTHQKTLFR
ARTM_SHIFL      GPG-QFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKKDTL-A
ARTM_ECOLI      GPG-QFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKKDTL-A
ARTM_ECOL6      GPG-QFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKKDTL-A
ARTM_ECO57      GPG-QFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKKDTL-A
TCYM_BACSU      GIPPVADQVSSFFHLGEIPVSMFV--IMALSLTAGAYLTEIIRSGILAMDTGQVEAAYSIGLTYSQTFRR
GLNM_BACSU      GLPNA-----------GLRLDGFQAGTVALTIYTSAFIAEAIRAGIQSVSKGQMEAARSSGFTYSQAMLH
YCKA_BACSU      GFPY----------IG-IEFSAVTAALIGFSLNSAAYIAEINRSAISSVEKGQWEAASSLGLSYWQTMRG
BZTC_RHOCA      ------------------NFDLILRVVILVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWQAQRL
AAPM_RHIL3      MLPLFLPTGW--------NVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTRL
YECS_SHIFL      GLP--------QFG---IELDPIPSAMIGLSLNTXXXXXXXXXXXISSIDKGQWEAAASIGMTPWQTMRR
YECS_ECOLI      GLP--------QFG---IELDPIPSAMIGLSLNTXXXXXXXXXXXISSIDKGQWEAAASIGMTPWQTMRR
YECS_ECOL6      GLP--------QFG---IELDPIPSAMIGLSLNTXXXXXXXXXXXISSIDKGQWEAAASIGMTPWQTMRR
ARTQ_BACSU      GLPQLLG----------FQIDQFWXXXXXXXXXXXXXXXEIIRAGINAIDKGQKEAAVALGVPYGKMMKD
Y4TG_RHISN      -----------------------LTGALALGIQYSAYISEVYRGGIQAVDHGQREAAKSLDLPPARTFTH
GLTK_ECOLI      --LIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKL
GLTK_ECOL6      --LIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKL
GLTK_ECO57      --LIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKL
OCCM_RHIRD      GLSQF----------------PDVRHSFIWPFLRDAYWCEIMRGGLLSVPAGQIEAAKACGMGRVKLFRR
YHDY_ECOLI      MLPLFMAEGTS--------IDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGL
PATM_VIBHA      -----------------VGIDAFSAAVIGLTLHFAAYMAESIRAAIIGIDRSQMEASLSVGMTTTQAMRR
GLTJ_ECOLI      WYLVIPELLPEKIGMWKAELDPNISSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRY
GLTJ_ECOL6      WYLVIPELLPEKIGMWKAELDPNISSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRY
TCYL_BACSU      GIP----ALTGLIGIDTSKMDPFYXXXXXXXXXXXXXXXXXXXXGVGSVDKGQTEAAYSIGLSGSQAFRR
AAPQ_RHIL3      GFPLTFDVPVAGLTGGSVVGPEFMSLFLALSFYTASFIAEIVRGGIRGVPKGQSEAAGALGLHPSSVTRL
ARTM_HAEIN      G-----------PGQFQWIIDSPLWYVLSNAWFXXXYSTQLFHGAVKAIPKGQWESCGALGLNRIQTL-K
GLUC_COREF      GLYQNLGLTLAGRDSSTFLADNNFR-LAVLGFILSAFVAESLRSGINTVHFGQAEAARSLGLGFSDIFRS
GLUC_CORGL      GLYQNLGLTLAGRESSTFLVDNNFR-LAVLGFILSTFVAESLRSGINTVHFGQAEAARSLGLGFGATFRS
YHDX_ECOLI      ---------------GMVLIPELAALTLALSVYTSAFIAEIIRAGIQAVPYGQHEAARSLGLPNPVTLRQ
GLUD_CORGL      QMFAQYNIVPSS----QLAFAAVVFGLTMYN---GSVIAEILRSGIASLPKGQKEAAIALGMSSRQTTWS
GLNP_BACSU      -----------------------------------AMLSEIIRSGLKSIDKGQIEAARSSGLSYTQTLFF
GLUD_COREF      -----LFARYQLVPSRQLAFAAVVFGLTMYN---GSVIAEILRSGIASLPKGQREAAIALGMSTRQTTWS
METI_YERPE      FTRMIVGT---SIGL-QAAIVPLTVGA-------APFIARMVENALLEIPSGLVEAARAMGATPMQIIKK
METI_VIBCH      VTKLIVGTFIGTTAA----IVPLTIGAIP-------FVARLIESALLEVPTGLVEAAQSMGATPLQIIRK
METI_SALTY      FTRIIVGT---SIGL-QAAIVPLTVGA-------APFIARMVENALLEIPAGLIEASRAMGATPLQIVRK
METI_SALTI      FTRIIVGT---SIGL-QAAIVPLTVGA-------APFIARIVENALLEIPAGLIEASRAMGATPLQIVRK
METI_ECOLI      FTRVIVGT---SIGL-QAAIVPLTVGA-------APFIARMVENALLEIPTGLIEASRAMGATPMQIVRK
METI_ECO57      FTRVIVGT---SIGL-QAAIVPLTVGA-------APFIARMVENALLEIPTGLIEASRAMGATPMQIVRK
PSTA2_MYCTU     ----------------------LAAGVLVLSVMSIPYIAKATESALAQVPTSYREAAEALGLPAGWALRK
PSTA2_MYCBO     ----------------------LAAGVLVLSVMSIPYIAKATESALAQVPTSYREAAEALGLPAGWALRK


                         +         .         .         .         .         *         .:210
query           IMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQLAGKSTWEPFYFAIVCGVIYLVFTTVSNG
HISQ_ECOLI      IMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQLAGKSTWEPFYFAIVCGVIYLVFTTVSNG
HISQ_SALTY      IMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGLIYLVFTTVSNG
HISQ_SALTI      IMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGLIYLVFTTVSNG
NOCQ_AGRT5      VLIPQAARFALPGLGNVWQFTLKDTSLISVVGLVEIMRTAAMGAGSTKQPFTFYITAFVIFLLLSSVSNR
OCCQ_RHIRD      IVLPQAARYALPGVGNVWQLVLKESALISVIGLVELMRQAQVGSGSTRQPFSFXXXXXXXXXXITFVSGQ
OCCQ_AGRT4      IVLPQAARYALPGVGNVWQLVLKESALISVIGLVELMRQAQVGSGSTRQPFSFXXXXXXXXXXITFVSGQ
ARTQ_HAEIN      IVMPQVWRHALPGLSTQWLVLLKDTALVSLIGVDDLMHQADLINTNTHQPFTWYGIAALIYLAVTLISQV
ARTQ_SHIFL      LVMPQMWRHALPGLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVITLLSQY
ARTQ_ECOLI      LVMPQMWRHALPGLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVITLLSQY
ARTQ_ECOL6      LVMPQMWRHALPGLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVITLLSQY
OCCQ_RHIME      IILPQAARHALPGVGNVWQLVLKESALISVIGLVELMRQAQVGSGSTRQPF-------------------
NOCM_AGRT5      IVFPIAIRQALPAYGNEVMLIIKSTSLASTITIVEVTGLAKQIISATYSPVEVFIVAGAIYLFITFVVSR
YXEN_BACSU      IILPQAIRNAIPATGNTFIGLLKETSLAFTLGVMEMFAQGKMYASGNLKYFETYLAVAIVYWVLTIIYSI
Y1079_HAEIN     TIMPQALRISVPSLSNTFISTVKDTSLASLVLVTELFRVAQNITAANYEFILIYSEAALIYWIFCF----
GLNP_RICPR      IILPQAINNIFPSLVNELVNLIKESAIISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILVILISF
GLNP_SHIFL      VIXXXXXXXXXXXXGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIITLVLSF
GLNP_ECOLI      VIXXXXXXXXXXXXGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIITLVLSF
GLNP_ECOL6      VIXXXXXXXXXXXXGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIITLVLSF
GLNP_ECO57      VIXXXXXXXXXXXXGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIITLVLSF
GLNP_RICBR      IILPQAIKNIFPSLTNELINLIKESAIISMFGEMDLMKRAQIVSLETYNYFFPMIVAACCYYILVMLISF
HISM_SHIFL      IILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPF-------------------
HISM_ECOLI      IILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPF-------------------
HISM_ECOL6      IILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPF-------------------
HISM_ECO57      IILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINAATYQPF-------------------
HISM_SALTY      IILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSATYQPF-------------------
HISM_SALTI      IILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSATYQPF-------------------
GLNP_RICFE      IILPQAVKNIFPSLVNELVNLVKESAIISMLGEMDLMRRAQIVSIETYNYFFPMFIAACCYYILVMLISF
GLNP_RICCN      IILPQAVKNIFPSLVNELVNLIKESAIISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILVMLISF
GLNP_RICTY      IILPQAINNIFPSLVNELINLIKESAIISMLGEMDLMRRAQIVSIETYNYFFPMLIAACCYYILVMLISF
OCCM_RHIME      IIIPQAIRQMLPGYSNEVVLMVKSTSLASTITLMEITGIAAKLISETYRPVEVFACAGAIYLTMNFIAAR
Y4TF_RHISN      VALPQAIPEMMPSFSNLAIAALKDTSLVSLITLHDLTFAAE-----------------------------
TCYB_BACSU      VILPQAFRVSIPPLSNTFISLIKDTSLASILVAELFRKAQEIGARNLDQILVIYIEAAFIYWIICFLLSL
ARTM_SHIFL      ILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMVFG-AAGIIYLVVNGLLTL
ARTM_ECOLI      ILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMVFG-AAGIIYLVVNGLLTL
ARTM_ECOL6      ILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMVFG-AAGIIYLVVNGLLTL
ARTM_ECO57      ILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMVFG-AAGIIYLVVNGLLTL
TCYM_BACSU      VILPQALKVSIPNFTNLGIGFLHTTSIAAIVAVPEITGTATIVASDNYAFLEAFIGAAIIYWVLTLIANG
GLNM_BACSU      IILPQAIKIVIPPLGNQFLNLVKNSSILGVVAGLDLMYQADLVSSSTLVVFDVYIFVALFYLVLTIPLSI
YCKA_BACSU      IILPQSIRIALPPLANVLLDLIKASSLAAMITVPELLQHAKIIGGREFDYMTMYILTALIYWAICSIAAV
BZTC_RHOCA      IIMPQALKISIPGIVSSFIGLFKDTTLVAFVGLFDPLKGSDMAWKGTWEPYIFV---ALIFFLFNFSMSR
AAPM_RHIL3      IIMPQAIKLVIPSIVNTFIGTFKDTSLVTIIGMFDLLGIVKLFSDANWTPITGLIFAGFIFWLFCFGMSR
YECS_SHIFL      AILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMATV---
YECS_ECOLI      AILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMATV---
YECS_ECOL6      AILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMATV---
ARTQ_BACSU      LLLPQAFKNISPAIVNELITLTKESAIVTVIGLGDVMRRAYQAGAATYNYLEPLIIAGLIYYVLVLILTF
Y4TG_RHISN      VILPQAIPRVIPALGNYLVSIMKDVPVLSVVTIVEMLNAAKIIGDQTFNYLVPLSMVGGIYLILTIVASA
GLTK_ECOLI      IILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASL
GLTK_ECOL6      IILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASL
GLTK_ECO57      IILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASL
OCCM_RHIRD      IVIPQAIRQMLPGYSNEVILMVKSTSLASTI---TIMEITGIAAKLISESYRTVEVAGAIYLILNFIVAR
YHDY_ECOLI      VILPQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQAGMST-EGYVFA---ALIYWIFCFSMSR
PATM_VIBHA      VILPQATRVALPSLMNYFIDMIKSTSLAFTLGVAEIMAKAQMXXXXXXXXXXXXLAVALIYWGVVVILTR
GLTJ_ECOLI      VLLPNAYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAQAGKLLDYSAWESFAYVLINAFIMLVMTLVERK
GLTJ_ECOL6      VLLPNAYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAQAGKLLDYSAWESFAYVLINAFIMLVMTLVERK
TCYL_BACSU      IVLPQALVQAFPNMGNMVISSLKDTSLAFSIGVMDMSGRGQTLITSSNHSLEVYIALSIVYYAVAVLFEW
AAPQ_RHIL3      VVVPQALRIIIPPLTSQYLNLTKNSSLAIAIGFSDLVAVGGTILNQSGQAIEIVCIWGIVYLSLSILTS-
ARTM_HAEIN      ILIPYALKRALPSYSNEIILVFKGTALASTITIMDIMYARQLYG--------------------------
GLUC_COREF      IIFPQAVRAAIIPLGNTLIALTKNTTIASVIG----VGEASLLMKSTIENH-----ANMLFVVFAIFAVG
GLUC_CORGL      IIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGELMKAT------------------------------
YHDX_ECOLI      VIIPQALRVIIPPLTSQYLNIVKNSSLAAAIGYPDMV---------------------------------
GLUD_CORGL      ILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSASVNRNYLAALFVVALIMIVLNFSLTA
GLNP_BACSU      IVMPQALRRMVPPIVSQFISLLKDTSLAVVIALPELIHNAQIINGQSADGSYFFPIFLLAALMYFAVNYS
GLUD_COREF      ILLPQAVAAMLPALIAQMVIALKDSALGYQIGYIEVVRS-------------------------------
METI_YERPE      VLLPE----ALPGLVN------------------------------------------------------
METI_VIBCH      VLLPE----ALPTILNSVTITL------------------------------------------------
METI_SALTY      ILLPE----ALPGLVN------------------------------------------------------
METI_SALTI      ILLPE----ALPGLVN------------------------------------------------------
METI_ECOLI      VLLPE----ALPGLVN------------------------------------------------------
METI_ECO57      VLLPE----ALPGLVN------------------------------------------------------
PSTA2_MYCTU     I----VLKTAMPGIVTGMLVAL------------------------------------------------
PSTA2_MYCBO     I----VLKTAMPGIVTGMLVAL------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VLLFLERRYSVGVKRADL
HISQ_ECOLI      VLLFLERRYSVGVKRADL
HISQ_SALTY      VLLLLERRYSVGVKRADL
HISQ_SALTI      VLLLLERRYSVGVKRADL
NOCQ_AGRT5      GFLKAEKWANRGVR----
OCCQ_RHIRD      VFRLAETRSMRGLQR---
OCCQ_AGRT4      VFRLAETRSMRGLQR---
ARTQ_HAEIN      GIRKLELRFT--------
ARTQ_SHIFL      ILKRIDLR----------
ARTQ_ECOLI      ILKRIDLR----------
ARTQ_ECOL6      ILKRIDLR----------
OCCQ_RHIME      ------------------
NOCM_AGRT5      LVMLAE------------
YXEN_BACSU      LQDLFERAMS--------
Y1079_HAEIN     VLSFLQDRLEIRLSR---
GLNP_RICPR      IAKIIEKKMIV-------
GLNP_SHIFL      ILRRLERRMKI-------
GLNP_ECOLI      ILRRLERRMKI-------
GLNP_ECOL6      ILRRLERRMKI-------
GLNP_ECO57      ILRRLERRMKI-------
GLNP_RICBR      IARIIEKKLIV-------
HISM_SHIFL      ------------------
HISM_ECOLI      ------------------
HISM_ECOL6      ------------------
HISM_ECO57      ------------------
HISM_SALTY      ------------------
HISM_SALTI      ------------------
GLNP_RICFE      IAKIIEKKMIV-------
GLNP_RICCN      IAKIIEKKMIV-------
GLNP_RICTY      IAKIIEKKMIV-------
OCCM_RHIME      LFALIE------------
Y4TF_RHISN      ------------------
TCYB_BACSU      VQHVIERR----------
ARTM_SHIFL      MMRLIERK----------
ARTM_ECOLI      MMRLIERK----------
ARTM_ECOL6      MMRLIERK----------
ARTM_ECO57      MMRLIERK----------
TCYM_BACSU      VLERKAARFQGG------
GLNM_BACSU      GVNYLEKR----------
YCKA_BACSU      FQNILEKKYA--------
BZTC_RHOCA      YSMYLERK----------
AAPM_RHIL3      YSGFMERHLDTGHKR---
YECS_SHIFL      ------------------
YECS_ECOLI      ------------------
YECS_ECOL6      ------------------
ARTQ_BACSU      IGKAVERK----------
Y4TG_RHISN      LVRIVD------------
GLTK_ECOLI      LVSYLKRR----------
GLTK_ECOL6      LVSYLKRR----------
GLTK_ECO57      LVSYLKRR----------
OCCM_RHIRD      LFTLLE------------
YHDY_ECOLI      YSQYLEKRFNTG------
PATM_VIBHA      VQIWAEAK----------
GLTJ_ECOLI      VRL---------------
GLTJ_ECOL6      VRL---------------
TCYL_BACSU      FFRVAEKR----------
AAPQ_RHIL3      ------------------
ARTM_HAEIN      ------------------
GLUC_COREF      FMI---------------
GLUC_CORGL      ------------------
YHDX_ECOLI      ------------------
GLUD_CORGL      LASRIERQLRAGRARKNI
GLNP_BACSU      LSLAARR-----------
GLUD_COREF      ------------------
METI_YERPE      ------------------
METI_VIBCH      ------------------
METI_SALTY      ------------------
METI_SALTI      ------------------
METI_ECOLI      ------------------
METI_ECO57      ------------------
PSTA2_MYCTU     ------------------
PSTA2_MYCBO     ------------------