[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ecol0:AAC77002.1

[Show Plain Result]


## Summary of Sequence Search
    1::296
    1::296     e-154 100%  296 aa  MALG_SHIFL RecName: Full=Maltose transport system permease protein
    1::296     e-154 100%  296 aa  MALG_ECOLI RecName: Full=Maltose transport system permease protein
    1::296     e-154 100%  296 aa  MALG_ECOL6 RecName: Full=Maltose transport system permease protein
    1::296     e-154 100%  296 aa  MALG_ECO57 RecName: Full=Maltose transport system permease protein
    1::296     e-149  92%  296 aa  MALG_SALTY RecName: Full=Maltose transport system permease protein
    1::296     e-149  88%  296 aa  MALG_SALTI RecName: Full=Maltose transport system permease protein
    1::296     e-148  94%  296 aa  MALG_ENTAE RecName: Full=Maltose transport system permease protein
    1::296     e-142  83%  296 aa  MALG_PHOLL RecName: Full=Maltose transport system permease protein
    8::303     e-141  83%  303 aa  MALG_YERPE RecName: Full=Maltose transport system permease protein
    1::296     e-125  76%  296 aa  MALG_VIBVY RecName: Full=Maltose transport system permease protein
    1::296     e-125  76%  296 aa  MALG_VIBVU RecName: Full=Maltose transport system permease protein
    1::296     e-125  75%  296 aa  MALG_VIBCH RecName: Full=Maltose transport system permease protein
    1::296     e-124  75%  296 aa  MALG_VIBPA RecName: Full=Maltose transport system permease protein
   38::283     7e-32  35%  283 aa  GANQ_BACSU RecName: Full=Putative arabinogalactan oligomer
   72::280     1e-31  37%  280 aa  MALD_STRR6 RecName: Full=Maltodextrin transport system permease
   72::280     1e-31  37%  280 aa  MALD_STRPN RecName: Full=Maltodextrin transport system permease
   41::280     1e-29  31%  280 aa  YCJP_ECOLI RecName: Full=Inner membrane ABC transporter permease
   68::278     4e-29  35%  278 aa  MDXG_BACSU RecName: Full=Maltodextrin transport system permease
   93::300     3e-28  37%  300 aa  YURM_BACSU RecName: Full=Probable ABC transporter permease protein
   86::296     7e-24  31%  296 aa  YESQ_BACSU RecName: Full=Probable ABC transporter permease protein
   62::275     9e-22  33%  276 aa  YJ16_PYRHO RecName: Full=Probable ABC transporter permease protein
   97::277     3e-17  31%  277 aa  Y4OR_RHISN RecName: Full=Probable ABC transporter permease protein
   78::277     3e-16  28%  282 aa  UGPE_AGRT5 RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     3e-16  28%  281 aa  UGPE_YERE8 RecName: Full=sn-glycerol-3-phosphate transport system
  217::379     1e-15  30%  380 aa  AGLG_RHIME RecName: Full=Alpha-glucoside transport system permease
  167::279     1e-14  35%  279 aa  ARAQ_BACHD RecName: Full=L-arabinose transport system permease
  142::281     5e-14  27%  281 aa  ARAQ_BACSU RecName: Full=L-arabinose transport system permease
   71::273     1e-13  26%  274 aa  AMYC_THETU RecName: Full=Probable starch degradation products
   67::273     2e-13  24%  273 aa  LACG_RHIRD RecName: Full=Lactose transport system permease protein
   91::275     3e-13  27%  275 aa  YOR2_CALSR RecName: Full=Putative ABC transporter permease protein
   72::276     3e-13  28%  281 aa  UGPE_SALTI RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     1e-12  28%  281 aa  UGPE_SALTY RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     1e-12  28%  281 aa  UGPE_SALPA RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     1e-12  28%  281 aa  UGPE_SALCH RecName: Full=sn-glycerol-3-phosphate transport system
   78::277     1e-12  26%  282 aa  UGPE_BRUME RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     1e-12  27%  281 aa  UGPE_ERWCT RecName: Full=sn-glycerol-3-phosphate transport system
   78::277     1e-12  27%  282 aa  UGPE_BRUAB RecName: Full=sn-glycerol-3-phosphate transport system
   78::277     1e-12  27%  282 aa  UGPE_BRUA2 RecName: Full=sn-glycerol-3-phosphate transport system
   85::275     2e-12  28%  275 aa  Y1216_PYRHO RecName: Full=Probable ABC transporter permease protein
   78::277     6e-12  25%  282 aa  UGPE_BRUSU RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     8e-12  26%  281 aa  UGPE_YERPS RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     8e-12  26%  281 aa  UGPE_YERPN RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     8e-12  26%  281 aa  UGPE_YERPE RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     8e-12  26%  281 aa  UGPE_YERPA RecName: Full=sn-glycerol-3-phosphate transport system
   72::286     1e-11  26%  286 aa  YTCP_BACSU RecName: Full=Probable ABC transporter permease protein
  100::277     4e-11  26%  282 aa  UGPE_RHIME RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     2e-10  26%  281 aa  UGPE_SHIF8 RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     4e-10  26%  281 aa  UGPE_SHIFL RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     4e-10  26%  281 aa  UGPE_ECOUT RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     4e-10  26%  281 aa  UGPE_ECOL6 RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     4e-10  26%  281 aa  UGPE_ECOL5 RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     4e-10  26%  281 aa  UGPE_ECOK1 RecName: Full=sn-glycerol-3-phosphate transport system
   72::276     4e-10  26%  281 aa  UGPE_ECO57 RecName: Full=sn-glycerol-3-phosphate transport system
   72::235     5e-10  27%  281 aa  UGPE_ECOLI RecName: Full=sn-glycerol-3-phosphate transport system
   93::228     1e-09  26%  229 aa  YOE1_STRAT RecName: Full=Putative ABC transporter permease protein
   62::206     1e-09  28%  264 aa  POTC_SHIFL RecName: Full=Spermidine/putrescine transport system
   62::206     1e-09  28%  264 aa  POTC_ECOLI RecName: Full=Spermidine/putrescine transport system
   62::206     1e-09  28%  264 aa  POTC_ECOL6 RecName: Full=Spermidine/putrescine transport system
   62::206     1e-09  28%  264 aa  POTC_ECO57 RecName: Full=Spermidine/putrescine transport system
   60::228     2e-09  30%  261 aa  WTPB_ARCFU RecName: Full=Molybdate/tungstate transport system
   72::276     2e-09  26%  281 aa  UGPE_SHIDS RecName: Full=sn-glycerol-3-phosphate transport system
   52::231     2e-09  27%  506 aa  FBPB2_HAEIN RecName: Full=Fe(3+)-transport system permease protein
   99::295     4e-09  27%  295 aa  LPLC_BACSU RecName: Full=Protein lplC;
   99::251     5e-09  34%  290 aa  MSMF_STRMU RecName: Full=Multiple sugar-binding transport system
   75::242     1e-08  31%  247 aa  WTPB_PYRKO RecName: Full=Molybdate/tungstate transport system
   80::272     2e-08  27%  288 aa  CYST_ZYGCR RecName: Full=Probable sulfate transport system permease
  187::229     3e-08  56%  293 aa  YCJO_SHIFL RecName: Full=Inner membrane ABC transporter permease
  187::229     3e-08  56%  293 aa  YCJO_ECOLI RecName: Full=Inner membrane ABC transporter permease
   66::246     1e-07  31%  291 aa  CYSW_ECOLI RecName: Full=Sulfate transport system permease protein
   66::246     1e-07  31%  291 aa  CYSW_ECOL6 RecName: Full=Sulfate transport system permease protein
    9::181     2e-07  25%  229 aa  MODB_HAEIN RecName: Full=Molybdenum transport system permease
   68::277     2e-07  23%  277 aa  MSMG_STRMU RecName: Full=Multiple sugar-binding transport system
   76::254     2e-07  28%  269 aa  CYST_MESVI RecName: Full=Probable sulfate transport system permease
   65::273     3e-07  28%  286 aa  CYSW_SYNE7 RecName: Full=Sulfate transport system permease protein
   82::243     4e-07  31%  277 aa  CYST_SALTY RecName: Full=Sulfate transport system permease protein
  120::241     4e-07  30%  266 aa  CYST_CHLVU RecName: Full=Probable sulfate transport system permease
   45::233     6e-07  26%  255 aa  CYST_PROWI RecName: Full=Probable sulfate transport system permease
  175::274     1e-06  29%  289 aa  Y2990_BRUA2 RecName: Full=Probable ABC transporter permease protein
  175::274     1e-06  29%  289 aa  Y2783_BRUAB RecName: Full=Probable ABC transporter permease protein
   93::222     2e-06  32%  286 aa  CYST_CHLAT RecName: Full=Probable sulfate transport system permease
   82::193     4e-06  33%  257 aa  POTC_HAEIN RecName: Full=Spermidine/putrescine transport system
   80::186     4e-06  28%  229 aa  MODB_ECOLI RecName: Full=Molybdenum transport system permease
   80::186     4e-06  28%  229 aa  MODB_ECO57 RecName: Full=Molybdenum transport system permease
   58::238     9e-06  25%  270 aa  CYST_HELSJ RecName: Full=Probable sulfate transport system permease
  172::299     2e-05  30%  313 aa  YDCU_ECOLI RecName: Full=Inner membrane ABC transporter permease
  175::274     2e-05  27%  289 aa  Y3749_BRUSU RecName: Full=Probable ABC transporter permease protein
   91::220     3e-05  29%  284 aa  CYST_NEPOL RecName: Full=Probable sulfate transport system permease
  178::220     3e-05  42%  292 aa  AMYD_THETU RecName: Full=Probable starch degradation products
  159::218     3e-05  32%  281 aa  POTI_ECOLI RecName: Full=Putrescine transport system permease
  159::218     3e-05  32%  281 aa  POTI_ECOL6 RecName: Full=Putrescine transport system permease
  262::450     3e-05  28%  530 aa  MALF_YERPE RecName: Full=Maltose transport system permease protein
  102::262     4e-05  32%  317 aa  POTH_ECOLI RecName: Full=Putrescine transport system permease
   67::270     4e-05  26%  288 aa  CYST_ANTFO RecName: Full=Probable sulfate transport system permease
  300::356     8e-05  35%  435 aa  MALC_STRR6 RecName: Full=Maltodextrin transport system permease
  300::356     8e-05  35%  435 aa  MALC_STRPN RecName: Full=Maltodextrin transport system permease
  378::516     1e-04  32%  518 aa  MALF_PHOLL RecName: Full=Maltose transport system permease protein
   34::169     1e-04  30%  227 aa  YVGM_BACSU RecName: Full=Putative molybdenum transport system
   82::249     1e-04  31%  309 aa  Y4OQ_RHISN RecName: Full=Probable ABC transporter permease protein
   76::243     1e-04  27%  248 aa  WTPB_PYRAB RecName: Full=Molybdate/tungstate transport system
  190::306     2e-04  31%  309 aa  YQGH_BACSU RecName: Full=Probable ABC transporter permease protein
   38::267     2e-04  27%  275 aa  POTB_SHIFL RecName: Full=Spermidine/putrescine transport system
   66::278     2e-04  28%  286 aa  POTB_HAEIN RecName: Full=Spermidine/putrescine transport system
   38::267     2e-04  27%  275 aa  POTB_ECOLI RecName: Full=Spermidine/putrescine transport system
   58::191     2e-04  35%  276 aa  CYSW_SYNY3 RecName: Full=Sulfate transport system permease protein
   67::270     2e-04  22%  288 aa  CYST_MARPO RecName: Full=Probable sulfate transport system permease
   48::277     3e-04  27%  287 aa  POTB_SALTY RecName: Full=Spermidine/putrescine transport system
   48::277     3e-04  27%  287 aa  POTB_SALTI RecName: Full=Spermidine/putrescine transport system
  402::522     4e-04  34%  569 aa  Y4FN_RHISN RecName: Full=Probable ABC transporter permease protein
   82::243     4e-04  31%  277 aa  CYST_ECOLI RecName: Full=Sulfate transport system permease protein
  193::318     5e-04  28%  318 aa  Y189_MYCGE RecName: Full=Probable ABC transporter permease protein
  142::351     5e-04  24%  632 aa  FBPB1_HAEIN RecName: Full=Putative ferric transport system permease
  113::166     6e-04  33%  222 aa  YECS_SHIFL RecName: Full=Inner membrane amino-acid ABC transporter
  113::166     6e-04  33%  222 aa  YECS_ECOLI RecName: Full=Inner membrane amino-acid ABC transporter
  113::166     6e-04  33%  222 aa  YECS_ECOL6 RecName: Full=Inner membrane amino-acid ABC transporter
  193::319     6e-04  31%  319 aa  Y136_MYCPN RecName: Full=Probable ABC transporter permease protein
  117::243     8e-04  27%  248 aa  WTPB_PYRHO RecName: Full=Molybdate/tungstate transport system
  182::226     8e-04  38%  295 aa  UGPA_SHIFL RecName: Full=sn-glycerol-3-phosphate transport system
  182::226     8e-04  38%  295 aa  UGPA_SHIF8 RecName: Full=sn-glycerol-3-phosphate transport system
  182::226     8e-04  38%  295 aa  UGPA_ECOUT RecName: Full=sn-glycerol-3-phosphate transport system
  182::226     8e-04  38%  295 aa  UGPA_ECOLI RecName: Full=sn-glycerol-3-phosphate transport system
  182::226     8e-04  38%  295 aa  UGPA_ECOL6 RecName: Full=sn-glycerol-3-phosphate transport system
  182::226     8e-04  38%  295 aa  UGPA_ECOL5 RecName: Full=sn-glycerol-3-phosphate transport system
  182::226     8e-04  38%  295 aa  UGPA_ECOK1 RecName: Full=sn-glycerol-3-phosphate transport system
  182::226     8e-04  38%  295 aa  UGPA_ECO57 RecName: Full=sn-glycerol-3-phosphate transport system
    1::296

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAMVQPKSQKXXXXXXXXXXXXXXXXXXXXXXMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQA
MALG_SHIFL      MAMVQPKSQKXXXXXXXXXXXXXXXXXXXXXXMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQA
MALG_ECOLI      MAMVQPKSQKXXXXXXXXXXXXXXXXXXXXXXMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQA
MALG_ECOL6      MAMVQPKSQKXXXXXXXXXXXXXXXXXXXXXXMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQA
MALG_ECO57      MAMVQPKSQKXXXXXXXXXXXXXXXXXXXXXXMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQA
MALG_SALTY      MAMVQPKSQKXXXXXXXXXXXXXXAAIMFPLLMVIAISLREGNFATGSLIPDKISWEHWRLALGFSVEHA
MALG_SALTI      MAMVQPKSQKLRLFITHLGLLIFIAAIMFPLLMVIAISLREGNFATGSLIPDKISWEHWRLALGFSVEHA
MALG_ENTAE      MAMVQPKSQKXXXXXXXXXXXXXXXXXXXXXXMVIAISLREGNFATGSLIPDTISWEHWRLALGFSVEHA
MALG_PHOLL      MAMVQPKSQKWRLLATHLLMFTFIAMILFPLLMVITISLRPGNFATGSLIPENISWEHWKLALGYSVVSP
MALG_YERPE      MAMVQPKSQRLRLLGTHFLMLCFIALIMFPLLMVIAISLRPGNFATGSLIPDQISWEHWKLALGMSVTHA
MALG_VIBVY      MAMVQGKSLKYRVWATHIALWAFLSMIIFPLLMIVAISFREGNFATGSLIPDNPSLEHWKLALGFSVTNA
MALG_VIBVU      MAMVQGKSLKYRVWATHIALWAFLSMIIFPLLMIVAISFREGNFATGSLIPDNPSLEHWKLALGFSVTNA
MALG_VIBCH      MAMVQGKSLKYRVWATHAALWVFLALIIFPLLMIVAISFREGNFATGSLIPDRPSLEHWKLALGIAVQNA
MALG_VIBPA      MAMVQGKSLKYRVWATHIAMWAFLALIIFPLLMIIAISFREGNFATGSLIPDNPTLDHWKLALGFSITNA
GANQ_BACSU      -------------------------------------SFNPGNLISTSIIPKHPTFDHYK-------ELF
MALD_STRR6      ----------------------------------------------------------------------
MALD_STRPN      ----------------------------------------------------------------------
YCJP_ECOLI      ---------------------------------------------------EAISLHPTLLPQQWTLEHY
MDXG_BACSU      ----------------------------------------------------------------------
YURM_BACSU      ----------------------------------------------------------------------
YESQ_BACSU      ----------------------------------------------------------------------
YJ16_PYRHO      ----------------------------------------------------------------------
Y4OR_RHISN      ----------------------------------------------------------------------
UGPE_AGRT5      ----------------------------------------------------------------------
UGPE_YERE8      ----------------------------------------------------------------------
AGLG_RHIME      ----------------------------------------------------------------------
ARAQ_BACHD      ----------------------------------------------------------------------
ARAQ_BACSU      ----------------------------------------------------------------------
AMYC_THETU      ----------------------------------------------------------------------
LACG_RHIRD      ----------------------------------------------------------------------
YOR2_CALSR      ----------------------------------------------------------------------
UGPE_SALTI      ----------------------------------------------------------------------
UGPE_SALTY      ----------------------------------------------------------------------
UGPE_SALPA      ----------------------------------------------------------------------
UGPE_SALCH      ----------------------------------------------------------------------
UGPE_BRUME      ----------------------------------------------------------------------
UGPE_ERWCT      ----------------------------------------------------------------------
UGPE_BRUAB      ----------------------------------------------------------------------
UGPE_BRUA2      ----------------------------------------------------------------------
Y1216_PYRHO     ----------------------------------------------------------------------
UGPE_BRUSU      ----------------------------------------------------------------------
UGPE_YERPS      ----------------------------------------------------------------------
UGPE_YERPN      ----------------------------------------------------------------------
UGPE_YERPE      ----------------------------------------------------------------------
UGPE_YERPA      ----------------------------------------------------------------------
YTCP_BACSU      ----------------------------------------------------------------------
UGPE_RHIME      ----------------------------------------------------------------------
UGPE_SHIF8      ----------------------------------------------------------------------
UGPE_SHIFL      ----------------------------------------------------------------------
UGPE_ECOUT      ----------------------------------------------------------------------
UGPE_ECOL6      ----------------------------------------------------------------------
UGPE_ECOL5      ----------------------------------------------------------------------
UGPE_ECOK1      ----------------------------------------------------------------------
UGPE_ECO57      ----------------------------------------------------------------------
UGPE_ECOLI      ----------------------------------------------------------------------
YOE1_STRAT      ----------------------------------------------------------------------
POTC_SHIFL      ----------------------------------------------------------------------
POTC_ECOLI      ----------------------------------------------------------------------
POTC_ECOL6      ----------------------------------------------------------------------
POTC_ECO57      ----------------------------------------------------------------------
WTPB_ARCFU      ----------------------------------------------------------------------
UGPE_SHIDS      ----------------------------------------------------------------------
FBPB2_HAEIN     ----------------------------------------------------------------------
LPLC_BACSU      ----------------------------------------------------------------------
MSMF_STRMU      ----------------------------------------------------------------------
WTPB_PYRKO      ----------------------------------------------------------------------
CYST_ZYGCR      ----------------------------------------------------------------------
YCJO_SHIFL      ----------------------------------------------------------------------
YCJO_ECOLI      ----------------------------------------------------------------------
CYSW_ECOLI      ----------------------------------------------------------------------
CYSW_ECOL6      ----------------------------------------------------------------------
MODB_HAEIN      ----------------------------------------------------------------------
MSMG_STRMU      ----------------------------------------------------------------------
CYST_MESVI      ----------------------------------------------------------------------
CYSW_SYNE7      ----------------------------------------------------------------------
CYST_SALTY      ----------------------------------------------------------------------
CYST_CHLVU      ----------------------------------------------------------------------
CYST_PROWI      ----------------------------------------------------------------------
Y2990_BRUA2     ----------------------------------------------------------------------
Y2783_BRUAB     ----------------------------------------------------------------------
CYST_CHLAT      ----------------------------------------------------------------------
POTC_HAEIN      ----------------------------------------------------------------------
MODB_ECOLI      ----------------------------------------------------------------------
MODB_ECO57      ----------------------------------------------------------------------
CYST_HELSJ      ----------------------------------------------------------------------
YDCU_ECOLI      ----------------------------------------------------------------------
Y3749_BRUSU     ----------------------------------------------------------------------
CYST_NEPOL      ----------------------------------------------------------------------
AMYD_THETU      ----------------------------------------------------------------------
POTI_ECOLI      ----------------------------------------------------------------------
POTI_ECOL6      ----------------------------------------------------------------------
MALF_YERPE      -------------------------------------------------------WENEKLSPGFTVSIG
POTH_ECOLI      ----------------------------------------------------------------------
CYST_ANTFO      ----------------------------------------------------------------------
MALC_STRR6      ----------------------------------------------------------------------
MALC_STRPN      ----------------------------------------------------------------------
MALF_PHOLL      ----------------------------------------------------------------------
YVGM_BACSU      ----------------------------------------------------------------------
Y4OQ_RHISN      ----------------------------------------------------------------------
WTPB_PYRAB      ----------------------------------------------------------------------
YQGH_BACSU      ----------------------------------------------------------------------
POTB_SHIFL      ----------------------------------------------------------------FTLDNY
POTB_HAEIN      ----------------------------------------------------------------------
POTB_ECOLI      ----------------------------------------------------------------FTLDNY
CYSW_SYNY3      ----------------------------------------------------------------------
CYST_MARPO      ----------------------------------------------------------------------
POTB_SALTY      ----------------------------------------------------------------FTLDNY
POTB_SALTI      ----------------------------------------------------------------FTLDNY
Y4FN_RHISN      ----------------------------------------------------------------------
CYST_ECOLI      ----------------------------------------------------------------------
Y189_MYCGE      ----------------------------------------------------------------------
FBPB1_HAEIN     ----------------------------------------------------------------------
YECS_SHIFL      ----------------------------------------------------------------------
YECS_ECOLI      ----------------------------------------------------------------------
YECS_ECOL6      ----------------------------------------------------------------------
Y136_MYCPN      ----------------------------------------------------------------------
WTPB_PYRHO      ----------------------------------------------------------------------
UGPA_SHIFL      ----------------------------------------------------------------------
UGPA_SHIF8      ----------------------------------------------------------------------
UGPA_ECOUT      ----------------------------------------------------------------------
UGPA_ECOLI      ----------------------------------------------------------------------
UGPA_ECOL6      ----------------------------------------------------------------------
UGPA_ECOL5      ----------------------------------------------------------------------
UGPA_ECOK1      ----------------------------------------------------------------------
UGPA_ECO57      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
MALG_SHIFL      DGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
MALG_ECOLI      DGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
MALG_ECOL6      DGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
MALG_ECO57      DGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
MALG_SALTY      DGRVTPPPFPVLLWLWNSVKIAGITAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
MALG_SALTI      DGRVTPPPFPVLLWLWNSVKIAGITAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
MALG_ENTAE      DGRVTPPPFPVLLWLWNSIKVAGITAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
MALG_PHOLL      DGRVTPPPFPVMLWLWNSVKVAFITAVGIVTLSTTCAYAFARMHFRGKSTLLKGMLIFQMFPAVLSLVAL
MALG_YERPE      DGSVTPPPFPVMLWLWNSIKIALITAMGIVALSTTCAYAFARMRFRGKSALLKGMLIFQMFPAVLSLVAL
MALG_VIBVY      DGSVTPPPFPVLTWLWNSVKVAGITSILIVALSTTSAYAFARLRFKGKETILKAMMIFQMFPXXXXXXXX
MALG_VIBVU      DGSVTPPPFPVLTWLWNSVKVAGITSILIVALSTTSAYAFARLRFKGKETILKAMMIFQMFPXXXXXXXX
MALG_VIBCH      DGSVTPPPFPVMTWLWNSVKVAGITSVLIVALSTTSAYAFARMRFKGKETILKAMMIFQMFPXXXXXXXX
MALG_VIBPA      DGTVTPPPFPVMTWLWNSVKVGGISAILIVALSTTSAYAFARMKFKGKNTILKAMMIFQMFPXXXXXXXX
GANQ_BACSU      AGKES---LQYVQWYVNSMKISLFTMAGSLLCVTFTAYAFSRFRFKGRKYALTLFLLLQMIPQFSALIAL
MALD_STRR6      -------------WYLNTLIIALITMAVQTSIIVLAGYAYSRYNFLARKQSLVFFLIIQMVPTMAALTAF
MALD_STRPN      -------------WYLNTLIIALITMAVQTSIIVLAGYAYSRYNFLARKQSLVFFLIIQMVPTMAALTAF
YCJP_ECOLI      VDIFNPMIFPFVDYFRNXXXXXXXXXXXXXFLGILGAYALSRLRFKGRMTINASFYTVYMFSGILLVVPL
MDXG_BACSU      -----------LNWYSNTLVIALSVMVLQVTIVTLAGYSYSRYRFAGRKKSLIFFLIIQMVPTMAALTAF
YURM_BACSU      -------------YFMNSVIVTALTCVITVFISAWAAYGLSRFEFKGKGFFLVLCLGGLMLTPQVSLVPL
YESQ_BACSU      ---------PFLTFIKNSAIIVGLSTIGAVMSSAVIAYGFARIPFKGKKFWFACMMGTLMLPHEVLMIPQ
YJ16_PYRHO      ------PMFPIGEGLKNSLIVAIPSTIVPVIVASLAAYAFARYSFPIKHYLFAFIVLLMALPQQMTVVPL
Y4OR_RHISN      -------------------------------------YALAHVTKRG-GTLLVAILVARIIPGIAIGVPV
UGPE_AGRT5      --------------LFNSFVVALAIAIGKIVISFLSAFAIVXXXXXXXXXXXWMIFITLMLPVEVRILPT
UGPE_YERE8      ---------PFGLMLFNSFVMAFAITVGKITVSMLSAYAIVYFRFPLRNLFFWLIFLTLMLPVEVRIFPT
AGLG_RHIME      ----------------------------------------------------------------MSLIPL
ARAQ_BACHD      ----------------------------------------------------------------------
ARAQ_BACSU      ----------------------------------------------------------------------
AMYC_THETU      ----------------NTLIITVFSILIIAIFSSMTAYALQRVKRKSSVIIYMIFTVAMLIPFQSVMIPL
LACG_RHIRD      ----------VPLVFWNSVKIALVGTALTLLVSSLAGYGFEMFRSKLRERVYTVILLTLMVPFAALMIPL
YOR2_CALSR      ------------------------------------AFAFSRFKFALNNLLYSLIIAGMAIPIHVTLIPI
UGPE_SALTI      ---------PFWLMMLNSFIMAFSITVGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_SALTY      ---------PFWLMMLNSFIMAFSITVGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_SALPA      ---------PFWLMMLNSFIMAFSITVGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_SALCH      ---------PFWLMMLNSFIMAFSITVGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_BRUME      --------------LWNSFVVAMAIAVGKIIISFMSAFAIVXXXXXXXXXXXXXXXXTLMLPVEVRILPT
UGPE_ERWCT      ---------PFGLMLLNSFVMALAITVGKITVSILSAYAIVYFRFPLRNLFFWMIFLTLMLPVEVRIFPT
UGPE_BRUAB      --------------LWNSFVVAMAIAVGKIIISFMSAFAIVXXXXXXXXXXXXXXXXTLMLPVEVRILPT
UGPE_BRUA2      --------------LWNSFVVAMAIAVGKIIISFMSAFAIVXXXXXXXXXXXXXXXXTLMLPVEVRILPT
Y1216_PYRHO     -------------------------------LGSIAGFTIAKLVRGRVSRQLLALISFGIFPYQSILIPL
UGPE_BRUSU      --------------LWNSFVVAMAIAVGKIIISFMSAFAIVXXXXXXXXXXXXXXXXTLMLPVEVRILPT
UGPE_YERPS      ---------PFGLMLLNSFVMAFAITVGKITVSILSAYAIVYFRFPLRNLFFWLIFLTLMLPVEVRIFPT
UGPE_YERPN      ---------PFGLMLLNSFVMAFAITVGKITVSILSAYAIVYFRFPLRNLFFWLIFLTLMLPVEVRIFPT
UGPE_YERPE      ---------PFGLMLLNSFVMAFAITVGKITVSILSAYAIVYFRFPLRNLFFWLIFLTLMLPVEVRIFPT
UGPE_YERPA      ---------PFGLMLLNSFVMAFAITVGKITVSILSAYAIVYFRFPLRNLFFWLIFLTLMLPVEVRIFPT
YTCP_BACSU      -----------------SVFVTVIGTAVSMFLSSLMAYGLSRRDLIGRQPLMFLVVFTMLFSG--GMIPT
UGPE_RHIME      ------------------------------------AFAIVFFRFPLRMAFFWMIFITLMLPVEVRILPT
UGPE_SHIF8      ---------PFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_SHIFL      ---------PFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_ECOUT      ---------PFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_ECOL6      ---------PFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_ECOL5      ---------PFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_ECOK1      ---------PFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_ECO57      ---------PFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
UGPE_ECOLI      ---------PFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
YOE1_STRAT      ----------------------------------------------------------------------
POTC_SHIFL      ----------------HSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISL
POTC_ECOLI      ----------------HSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISL
POTC_ECOL6      ----------------HSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISL
POTC_ECO57      ----------------HSLTMAVFSATFATLIGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISL
WTPB_ARCFU      -----------------------ISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIAL
UGPE_SHIDS      ---------PFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRN------LFFWMIFITLMLPVE
FBPB2_HAEIN     --------------LSNTMLLMVCVTIGAISLGTFCAFLLERYRFFGKAFFEVAMTLPLCIPAFVSGFTW
LPLC_BACSU      ----------------------------------TMAYPLAKRHVKGRNLLLNLVIFSMLFSG--GMIPT
MSMF_STRMU      ---------------------------------------------------IKGKTFFRFFPAVLSGLTV
WTPB_PYRKO      -------------------------------------YVLARKDFPGKSAVQALVDVPIVIPSVVGIMLL
CYST_ZYGCR      ---------------------AALAAVINAFLGLILAWILVRYRFPGKNFLDAAVLPFALPTSVLTLMTV
YCJO_SHIFL      ----------------------------------------------------------------------
YCJO_ECOLI      ----------------------------------------------------------------------
CYSW_ECOLI      --------------IWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIFAVSPVVAGLV--
CYSW_ECOL6      --------------IWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIFAVSPVVAGLV--
MODB_HAEIN      -----------------SLSVAVSSMLWSLPLAIFVAWLLARKNFYGKSLITXXXXXXXXXXXXXXXXXX
MSMG_STRMU      -------------YFWNXXXXXXXXXXXXMLFIPAAAYSIARNMSRRKANIMYSLLILGIFPFQVIMIPI
CYST_MESVI      ------------------------------------AWILVRYNFPGKRIVDAAIDLPFALPAGLTLATV
CYSW_SYNE7      --------------LQEAIRLTLLMGVISVPLNTAAAFAIARKQFPGKSLLLSVILPFSISPVVAGLM-I
CYST_SALTY      ------------------------------------AWILTRYRFPGRTLLDALMDLPFALPTAVAGLTL
CYST_CHLVU      ----------------------------------------------------------------------
CYST_PROWI      -----------------TIKMALIAALFNSIFGFLITWVITRYEFKGKKFIDAAVDLPFALPAGLTLATV
Y2990_BRUA2     ----------------------------------------------------------------------
Y2783_BRUAB     ----------------------------------------------------------------------
CYST_CHLAT      ------------------------------------AWVLVRYNFPGKRIIDAAIDLPFALPAGLTLATV
POTC_HAEIN      ------------------------------------AIALYRYRFRGKQAVSGMLFIVMMSPDIVMAVSL
MODB_ECOLI      ----------------------------------------------------------------------
MODB_ECO57      ----------------------------------------------------------------------
CYST_HELSJ      -----------------TIKMALYTAIINTIFGFIIAWVLTRYNFSGKRIMDAIVDLPLALPTSVAGLAL
YDCU_ECOLI      ----------------------------------------------------------------------
Y3749_BRUSU     ----------------------------------------------------------------------
CYST_NEPOL      ------------------------------------AWVLVRYEFPGRRLLDAAVDLPFALPAGLTLATV
AMYD_THETU      ----------------------------------------------------------------------
POTI_ECOLI      ----------------------------------------------------------------------
POTI_ECOL6      ----------------------------------------------------------------------
MALF_YERPE      DEGIQKPFISIFIWLFSVMSVTFTVAVGMVL---ACVVQWDSLK--GKAIYRVMLILPYAVPSFISILIF
POTH_ECOLI      -----------------SLQVAAISTFCCLLIGYPLAWAVAHSK-PSTRNIL---LLLVILPSWTSLIRV
CYST_ANTFO      ---------PIILSAYATTFSTAFLAITINALGLIIAWILVKYEFTGKETLDAIVDLPFALPASLTLMTV
MALC_STRR6      ----------------------------------------------------------------------
MALC_STRPN      ----------------------------------------------------------------------
MALF_PHOLL      ----------------------------------------------------------------------
YVGM_BACSU      -------------------------------LGTLAGAWMSRASFFGKTALETCFMLPLVLPPTVVGFIL
Y4OQ_RHISN      ---------------WAAIRVTLIYAVVAVSLECALGILFANLEFFGRGLFRSLMLIPMVIPAVVGIFLL
WTPB_PYRAB      -------------------------------------YVLARKDFRGKSLVQAIIDVPIVIPSVVGIMLL
YQGH_BACSU      ----------------------------------------------------------------------
POTB_SHIFL      TRLLDPLYFEVLL---HSLNMALIATLACLVLGYPFAWFLAKL--PHKVRPLLLFLLIVPF-WTNSLIRI
POTB_HAEIN      --------------VWNSLSMSGIATIICLLIGYPFAFMMSKIHWTNSLIRIYGMKVFLGVKGILNTM--
POTB_ECOLI      TRLLDPLYFEVLL---HSLNMALIATLACLVLGYPFAWFLAKL--PHKVRPLLLFLLIVPF-WTNSLIRI
CYSW_SYNY3      ----------------SALQLTVVMALISVPLNTVAAWVLARNQFPGRALFLSVLLPFSISPVVLMIVLL
CYST_MARPO      ---------PVVLSAYGFTFLTALLATIINAIGLILAWVLVRYEFPGKKLLDATVDLPFALPTSVGGLTL
POTB_SALTY      ARLLDPLYFEVLL---HSLNMALIATLSCLVLGYPFAWFLAKL--PEKIRPLLLFLLIVPF-WTNSLIRI
POTB_SALTI      ARLLDPLYFEVLL---HSLNMALIATLSCLVLGYPFAWFLAKL--PEKIRPLLLFLLIVPF-WTNSLIRI
Y4FN_RHISN      -----------------------------------------------------------IIPTMLLAVGL
CYST_ECOLI      ------------------------------------AWILTRYRFPGR-TLLDALLPFALPTAVLTLASL
Y189_MYCGE      ----------------------------------------------------------------------
FBPB1_HAEIN     ----------------NSLFLSGF--VGIVSTVFGLAFALYTTRIARRTAFIGK--IFSILPIVTPPLGV
YECS_SHIFL      ----------------------------------------------------------------------
YECS_ECOLI      ----------------------------------------------------------------------
YECS_ECOL6      ----------------------------------------------------------------------
Y136_MYCPN      ----------------------------------------------------------------------
WTPB_PYRHO      ----------------------------------------------------------------------
UGPA_SHIFL      ----------------------------------------------------------------------
UGPA_SHIF8      ----------------------------------------------------------------------
UGPA_ECOUT      ----------------------------------------------------------------------
UGPA_ECOLI      ----------------------------------------------------------------------
UGPA_ECOL6      ----------------------------------------------------------------------
UGPA_ECOL5      ----------------------------------------------------------------------
UGPA_ECOK1      ----------------------------------------------------------------------
UGPA_ECO57      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
MALG_SHIFL      YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
MALG_ECOLI      YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
MALG_ECOL6      YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
MALG_ECO57      YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
MALG_SALTY      YALFDRLGQYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
MALG_SALTI      YALFDRLGQYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
MALG_ENTAE      YALFDRLGQYLPFVGLNTHGGVIFAYMGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLVPL
MALG_PHOLL      YALFDRLGEYVPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRMVLLPL
MALG_YERPE      YALFDRIGQYMPFIGLNTHGGVIFAYMGGIALHVWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPL
MALG_VIBVY      XXXFDKLGQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPL
MALG_VIBVU      XXXFDKLGQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPL
MALG_VIBCH      XXXFDKLGQYIPFLGLNTHGGLIFSYLGGIALHVWTIKGYFETIDRSLEEAAALDGATPWQAFRLVLLPL
MALG_VIBPA      XXXFDKLGQYIPFLGLNTHGGLIFAYLGGIALHVWTIKGYFESIDSSLEEAAALDGATPWQAFRLVLLPL
GANQ_BACSU      FVLAQILGM------INSHXXXXXXXXXXXPMNTYLMKGYMDSIPMDLDESAKIDGASSTRIFFQIILPL
MALD_STRR6      FVMALMLN------ALNHNWFLIFLYVGGIPMNAWLMKGYFDTVPMSLDESAKLDGAGHFRRFWQIVLPL
MALD_STRPN      FVMALMLN------ALNHNWFLIFLYVGGIPMNAWLMKGYFDTVPMSLDESAKLDGAGHFRRFWQIVLPL
YCJP_ECOLI      FKIITALGIYDTEMAL-----IITMVTQTLPTAVFMLKSYFDTIPDEIEEAAMMDGLNRLQIIFRITVPL
MDXG_BACSU      YVLAMLIG------ALDQYWFLTAIYIGGIPMNTWLMKGYFDTVPREIDEAARIDGAGHLRIFASIVLPL
YURM_BACSU      YSIIQSLGLY------NTYWALILPYAARIPFTIILIRSYFLSISKELEEAAYLDGCTSFGVFFRIFLPM
YESQ_BACSU      YIMFAKLD------WLNSFKPIVVPQFFGHAFFIFLMIQFIRTIPEELDEAARIDGCGRFACFWRIILPL
YJ16_PYRHO      YFLLRNAHL------LNTFRGLIIVHSAGLAWIIFFMRNYFSMLPTDVEEAAKIDGATDFQIFYKIVLPM
Y4OR_RHISN      YLLATRLHQ------LDTYQALIIINVANIPFAIWLMRSFFMEVHPTLREAAISDGCSEWQVFTKIMMPL
UGPE_AGRT5      YKVIVDLGL------IDTYAGLTLPLMAS-ATATFLFRQFFLTIPGELVEAARIDNAGPFRFMRDILLPL
UGPE_YERE8      IQVIANLNMLDSYTGLTLP-------LMASATATFLFRQFFMTLPDELLEAARIDGAGAMRFFWDIVLPL
AGLG_RHIME      LQLYNGVGAFFG-VSAKTYMGIWLAHTGGLPLAIYLLRNYMAGLPREIMESARVDGASDFDIFVKIILPL
ARAQ_BACHD      -------------------------------------------LPKELMDAARIDGCTEYGIFFKIMLPL
ARAQ_BACSU      ---------------IDSYTGVILPFIVS-PVAVFFFRQYALGLPRDLLDSARMDGCTEFGIFFRIMAPL
AMYC_THETU      VAEFGKFH-------FLTRSGLVFMYLGGSSLGVFLYYGALKGIPTSLDEAALIDGCSRFRIYWXXXXXX
LACG_RHIRD      FMLMGQAGL------LNTHIAIMLPMIAS-AFIIFYFRQASKAFPTELRDAAKVDGLKEWQIFFYIYVPV
YOR2_CALSR      YVLTNKIKLY----------DTVFALIGSLPMSIFILTEFMREIPLELEEAAKIDGCSMFRLYSDILLPL
UGPE_SALTI      VRIFPTVEVIANLKMLNSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFRDIVLPL
UGPE_SALTY      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFRDIVLPL
UGPE_SALPA      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFRDIVLPL
UGPE_SALCH      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFRDIVLPL
UGPE_BRUME      YKVIVDLGM------IDTYAGLTLPLMAS-ATATFLFRQFFLTIPGELVEAARIDNAGPFRFMRDILLPL
UGPE_ERWCT      VEVIARLDMMDSYTGLTLP-------LMASATATFLFRQFFMTLPDELMEAARIDGASPMRFFFDMVLPL
UGPE_BRUAB      YKVIVDLGM------IDTYAGLTLPLMAS-ATATFLFRQFFLTIPGELVEAARIDNAGPFRFMRDILLPL
UGPE_BRUA2      YKVIVDLGM------IDTYAGLTLPLMAS-ATATFLFRQFFLTIPGELVEAARIDNAGPFRFMRDILLPL
Y1216_PYRHO     VKIISSLGLYNRILGLITHT----AY--GIPITTLLFTNYYYEIPDELVEAAKIDGADPWKIYTKVILPL
UGPE_BRUSU      YKVIVDLGM------IDTYAGLTLPLMAS-ATATFLFRQFFLTIPGELVEAARIDNAGPFRFMRDILLPL
UGPE_YERPS      IEVIANLNLLDSYTGLTLP-------LMASATATFLFRQFFMTLPDELLEAARIDGAGAMRFFWDIVLPL
UGPE_YERPN      IEVIANLNLLDSYTGLTLP-------LMASATATFLFRQFFMTLPDELLEAARIDGAGAMRFFWDIVLPL
UGPE_YERPE      IEVIANLNLLDSYTGLTLP-------LMASATATFLFRQFFMTLPDELLEAARIDGAGAMRFFWDIVLPL
UGPE_YERPA      IEVIANLNLLDSYTGLTLP-------LMASATATFLFRQFFMTLPDELLEAARIDGAGAMRFFWDIVLPL
YTCP_BACSU      FLVVKSLGL------LDSYWALILPTAIN-AFNLIILKNFFQNIPSSLEESAKIDGCNDLGIFFKIVLPL
UGPE_RHIME      YKVIVDLGL------IDTYAGLTLPLMAS-ATATFLFRQFFLTIPGELVEAARIDNAGPFRFMRDILLPL
UGPE_SHIF8      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-AIATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPL
UGPE_SHIFL      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPL
UGPE_ECOUT      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPL
UGPE_ECOL6      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPL
UGPE_ECOL5      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPL
UGPE_ECOK1      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPL
UGPE_ECO57      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPL
UGPE_ECOLI      VRIFPTVEVIANLQMLDSYAGLTLPLMAS-ATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPL
YOE1_STRAT      --------------------GLVLVYVWSLPFALWMLAGHXXXXXXXXXXXXXVDGAGRVRTLTSVTVPL
POTC_SHIFL      LVLFMLLGIQLGFWSL------LFSHITFLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPL
POTC_ECOLI      LVLFMLLGIQLGFWSL------LFSHITFLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPL
POTC_ECOL6      LVLFMLLGIQLGFWSL------LFSHITFLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPL
POTC_ECO57      LVLFMLLGIQLGFWSL------LFSHITFLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPL
WTPB_ARCFU      LVVFGSIGSFSPLKFVDALPGIVVAMLVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPL
UGPE_SHIDS      VRIFPTVEVIANLKMLDSYAGLTLPLMAS-ATATFLFRQFFMILPDELVEAARIDGASPMRFFCDIVFPL
FBPB2_HAEIN     ISLTFRVEVFWGTIGIMTLSSFPLAYL--------PVSAILKRLDRSLEEVSLSLGKSPVYTFWYAISPQ
LPLC_BACSU      YLVVKSLGL------LDTYWALILP-MAINPFNLIIIKNFFQQLPRELEESAKIDGCSEIGVFWRIALPL
MSMF_STRMU      SLIFKQVFNYLPAVGLGTANGAVIASIQGVAMPIILFLSGLQSIPSEIVEAAAIDGADSKQTFWSVELPY
WTPB_PYRKO      VTFSNSI--------LDSYKGIVAAMLFVSAFTINAARDGFLAVDEKLEAVARTLGASRWRAFLSISLPM
CYST_ZYGCR      YSDKGWMGPICSWLGIKSRLGVLIAMMFSLPFIVRTIQPVLQSMEEETEEAAWCIGASPWTTFWNVLFPP
YCJO_SHIFL      -----------------------------------------QTIDKSLYEAAEMDGANAWQRFRIVTLPA
YCJO_ECOLI      -----------------------------------------QTIDKSLYEAAEMDGANAWQRFRIVTLPA
CYSW_ECOLI      YLLF--YGSNGPLGGLDEHNQIMFSWPGMVLVTIFVTCPFVVSQGSQEDEAAILLGASGWQMFRRVTLPN
CYSW_ECOL6      YLLF--YGSNGPLGGLDEHNQIMFSWPGMVLVTIFVTCPFVVSQGSQEDEAAILLGASGWQMFRRVTLPN
MODB_HAEIN      XXAMGRIGKYLYSFGFSWKGAVLSSAVVAFPLVVRAIRLSLENIDIKLEQAAQTLGASAWRVFFTITLPL
MSMG_STRMU      TVMMSKLG-------LANMWGLIILYLTAIPQTLFLYVGYIKSVPDSLDEAAEIDGADKLTTYRKIIFPM
CYST_MESVI      YSEKGWIGHFLQSLSIK----VVFTKLGGVAMIVRTLQPVLQDIEKELEEAAWSLGASSWTTFWKVIFPS
CYSW_SYNE7      VLLYGRNGWLGPLLESNDIK-IIFAWPGMALATIFVSMPFLEEIGTDAEEAASTLGANGWQTFWRVTLPS
CYST_SALTY      ASLFSVNGFYGQFLA-QFDIKVTYTWLGSIPFVVRTVQPVLEELGPEYEEAAQTLGATRLQSFRKVVLPE
CYST_CHLVU      -SLFNLFGFQIVFTKIGVLLAMIFVSFPFV---IRTLQPVLQEMEKSLEEAAWSLGASSWETFRKVILPT
CYST_PROWI      YGNQGWVGRFLKMGNLQTKFGVLLAMIFSFPFVIRSLQPVLQGLDHGLEEAAWCLGASSFQTFLRVIFPT
Y2990_BRUA2     --------------------------------------GGLSSIPDDLYEASSLEGASLWQQFREITFPL
Y2783_BRUAB     --------------------------------------GGLSSIPDDLYEASSLEGASLWQQFREITFPL
CYST_CHLAT      YSLFESIGIKVAFTRVGVAVAMIFVSFPFV---VRTLQPVLVEIDQELEEAAWSLGASTWRTFWRVIFPP
POTC_HAEIN      LALFMVVGISLGFWSL------LLAHVTFCLPYVTTIFSRLNGFDSRMLEAAKDLGASEVTILRKIILPL
MODB_ECOLI      --LYDWFGITFAF---SWRGAVLAAAVMSFPLMVRAIRLALEGVDVKLEQAARTLGAGRWRVFFTITLPL
MODB_ECO57      --LYDWFGITFAF---SWRGAVLAAAVMSFPLMVRAIRLALEGVDVKLEQAARTLGAGRWRVFFTITLPL
CYST_HELSJ      STVFGRNGDFYNYEIIYTKRGILLAMIFSFPFSVRAIQPILKEINKEEEEAAWSLGSGPLETFKRFIFPI
YDCU_ECOLI      ----------LPAVGGNTLSTLVFLYIW-LPFMILPVQAALERLPPSLLQASADLGARPRQTFRYVVLPL
Y3749_BRUSU     --------------------------------------GGLSSIPDDLYEASSLEGASLWQQFREITFPL
CYST_NEPOL      YSDQGWIGTWLSSLNIQTRLGVMLAMLFSFPFVVRTLQPVLQDMERELEEAAWSLGASPFNTFLRVLCPP
AMYD_THETU      ---------------------------------------YIESIPTDLIEASKIDGANSWQQFRNVVFPL
POTI_ECOLI      ------------------------------------ISSRLRELDRSIEEAAMDLGATPLKVFFVITLPM
POTI_ECOL6      ------------------------------------ISSRLRELDRSIEEAAMDLGATPLKVFFVITLPM
MALF_YERPE      KGLFNQSFGEINLMLSHLFGDPITAKSMILIVNTWLCMGLLKAIPDDLYEASAMDGAGPFQNFFRITFPL
POTH_ECOLI      YAWMGILNNFLLWLGLAVYIGIVYAYVPFMVLPIYTA---LIRIDYSLVEAALDLGARPLKTFFTVIVPL
CYST_ANTFO      YSDRGWMGPICSGLGLK----IVFSRLGSLPFVVRTIQPVLQDVEEELEEAAWCIGASPWTTFCQIXXXX
MALC_STRR6      -------------------------WLGFPYIYVLTL-GILQSIPNDLYEAAYIDGANAWQKFRNITFPM
MALC_STRPN      -------------------------WLGFPYIYVLTL-GILQSIPNDLYEAAYIDGANAWQKFRNITFPM
MALF_PHOLL      ---------------------VVNAWLGYPYMMILCM-GLLKAIPDDLYEASAMDGAGPFQNFFKITFPL
YVGM_BACSU      IVIFGKIGQAIEWIFQQP---VIFTWXXXFPLMYQSAKTGFADIDPDIQGAAMVDGASRWKVFIHISVPL
Y4OQ_RHISN      YELLGTLGEPVPWLSLTV------ALASVIIVDVWQSTPFFQSLDRDTVSAAQADGANALQVFRYLTLPH
WTPB_PYRAB      VTFSNAI--------LDSYKGIIAAMLFVSAFAINSARDGFLAVDEKLEHVARTLGASKLRTFFSISLPI
YQGH_BACSU      ------------------------------------------SLPKSLREGSYALGATRWQTIRKVLVPA
POTB_SHIFL      YGLKGYLNEFLLWLGIDTPIRIMFAVIIGLVFMVMPLYSSIEKLDKPLLEAARDLGASKLQTFIRIIIPL
POTB_HAEIN      --LIDMGILSAPIRILNTEIAVIIGYLL-LPFMILPLYSAIEKLDNRLLEAARDLGANTFQRFFRVILPL
POTB_ECOLI      YGLKGYLNEFLLWLGIDTPIRIMFAVIIGLVFMVMPLYSSIEKLDKPLLEAARDLGASKLQTFIRIIIPL
CYSW_SYNY3      YGKNGWIGSWVPGMAIAT----IFVTLPFVAREVIPV---LEELGPEQEEAARTLGAKDWQIFWRVTLP-
CYST_MARPO      MTVFNDKGWIKPIIVFNPIGVLLAMIFVSLPFVVRTIQPVLQNMEEDLEEAAWCLGASPWTTFWHIXXXX
POTB_SALTY      YGLKGYLNEFLLWLGIDTPIRIMFAVIIGLVFMVMPLYSSIEKLDKPLLEAARDLGASKMQTFIRIIIPL
POTB_SALTI      YGLKGYLNEFLLWLGIDTPIRIMFAVIIGLVFMVMPLYSSIEKLDKPLLEAARDLGASKMQTFIRIIIPL
Y4FN_RHISN      IVAFDAPN---PLVGLLPIGYVIFS----LPLMVRFMRSAFIGIDPAFDEAARAMGASGPYRLRRVVLPL
CYST_ECOLI      FSVNGFYGEWLAKFDIK----VTYTWLGSIPFVVRTVQPVXXXXXXXXXXXXXTLGATRWQSFCKVVLPE
Y189_MYCGE      ----------------------------------------FEAIPSQLKESALIDGCNGFNYFLKIALPM
FBPB1_HAEIN     TLMLGRSGYVTEFLGFSSHNGIAIAQILAFAISFMILDGALKSVHPSIEEASYTLRANRYQTFYQIIFPL
YECS_SHIFL      ------------------------------------------SIDKGQWEAAASIGMTPWQTMRRAILPQ
YECS_ECOLI      ------------------------------------------SIDKGQWEAAASIGMTPWQTMRRAILPQ
YECS_ECOL6      ------------------------------------------SIDKGQWEAAASIGMTPWQTMRRAILPQ
Y136_MYCPN      ----------------------------------------FEAIPPRIKESAFVDGCTGLRYFLKIAFPM
WTPB_PYRHO      ---------------LDSYKGIIAAMLFVSAFAINSARDGFLAVDEKLEHVARTLGASRIRTFFSISLPM
UGPA_SHIFL      -----------------------------------------QSIPRSLIEAAAIDGAGPIRRFFKIALPL
UGPA_SHIF8      -----------------------------------------QSIPRSLIEAAAIDGAGPIRRFFKIALPL
UGPA_ECOUT      -----------------------------------------QSIPRSLIEAAAIDGAGPIRRFFKIALPL
UGPA_ECOLI      -----------------------------------------QSIPRSLIEAAAIDGAGPIRRFFKIALPL
UGPA_ECOL6      -----------------------------------------QSIPRSLIEAAAIDGAGPIRRFFKIALPL
UGPA_ECOL5      -----------------------------------------QSIPRSLIEAAAIDGAGPIRRFFKIALPL
UGPA_ECOK1      -----------------------------------------QSIPRSLIEAAAIDGAGPIRRFFKIALPL
UGPA_ECO57      -----------------------------------------QSIPRSLIEAAAIDGAGPIRRFFKIALPL


                         .         .         .         +         .         .         .:280
query           SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
MALG_SHIFL      SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
MALG_ECOLI      SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
MALG_ECOL6      SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
MALG_ECO57      SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
MALG_SALTY      SVPILAVVFILSFIAAITEVPVASLLLRDVDSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITLVFLL
MALG_SALTI      SVPILAVVFILSFIAAITEVPVASLLLRDVDSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITLVFLL
MALG_ENTAE      SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITVVFLL
MALG_PHOLL      SVPILAVVFILSFIGVITEVPVASLLLRDVNNYTLAVGMQQYLNPQNYLWGDFAAAAVLSALPITIVFLV
MALG_YERPE      SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITTVFLL
MALG_VIBVY      SVPILAVVFILSFIGVVGEVPVASLLLSDVNSYTLAVGMQQYLYPQNYLWGDFAAAAVLSALPITIVFLL
MALG_VIBVU      SVPILAVVFILSFIGVVGEVPVASLLLSDVNSYTLAVGMQQYLYPQNYLWGDFAAAAVLSALPITIVFLL
MALG_VIBCH      SVPILAVVFILSFIGVVGEVPVASLLLSDVNSYTLAVGMQQYLYPQNYLWGDFAAAAVLSALPITIVFLL
MALG_VIBPA      SVPILAVVFILSFIMVIGEVPVASLLLSDVDSYTLAVGMQQYLYPQNYLWGDFAAAAVLSAVPITAVFLL
GANQ_BACSU      SKPMAAVVAMNGFTGPLGDFVLSSTILRTPESYTLPVGLFNLVNDMGASYTTFAAGALLISIPVAVIFIM
MALD_STRR6      VRPMVAVQALWAFMGPFGDYILSSFLLREKEYFTVAVGLQTFVNAKNLKIAYFSAGAILIALPICILFFF
MALD_STRPN      VRPMVAVQALWAFMGPFGDYILSSFLLREKEYFTVAVGLQTFVNAKNLKIAYFSAGAILIALPICILFFF
YCJP_ECOLI      AMSGLISVFVYCFMVAWNDYLFASIFLSSASNFTLPVGLNALFSTPDYIWGRMMAASLVTALPVVIMYAL
MDXG_BACSU      VKPMLAVQALWAFMAPFGDYLLTKFLLRSPERLTIAVGLQSFINPQQQKVXXXXXXXXXXXXPICVLFFF
YURM_BACSU      SVPILVTSGILTAYHTWNEFMFAIIFIDDENLRTIPAGLMQFRDALQTDWGVLLAGLTISAAPIIILFLL
YESQ_BACSU      IAPALATSAIFSFYWKWEELIQPLLYLNKPELYPVSLALKLFLDTESASWGAMFAMSAVSLLPVILVFFL
YJ16_PYRHO      ALPGLISASILQFTWVWSDFFLALVFLQNPEKY-VATQRLPLLRGQYFVWGLLTAASIMVMLVPLLVYAL
Y4OR_RHISN      VLGGMLATAVFVFIAVWNEFLFALILTTSV-SPTAPLAMLGFRTQYGVQWDAVGAAAFLVSTPVIAFAFI
UGPE_AGRT5      SRTNIAALFVILFIYGWTQYLWPLLVTNDAKMNTIIIGLKRMVDDASTPWNYVMVTAILAIIPPVMVVVL
UGPE_YERE8      SKTNLAALFVITFIYGWNQYLWPILITSDASMGTAVAGIRSMISSSGTQWNQVMAAMILTLIPPVAVVLL
AGLG_RHIME      SFPALASFAIFQFLWTWNDLLVAIVFLGAGDDKLVLTGLVNLLGSRGGNWEILTASAFITIVVPLIVFFA
ARAQ_BACHD      MGPSLAAMAILQGLNSWNNFLWPLVVLRSNDMFTLPIGLATLLTPYGNNYDILLAGSVMTIVPIVILFIF
ARAQ_BACSU      MKPAFGAMIILQSLNSWNNFLWPLIVLRSKEMFTLPIGLSSLLSPYGNNYDMLISGSVFAILPVIIIFLF
AMYC_THETU      XXXXXXXXAVLDIMWIWNDYLLPSLVINKVGSRTLPLMIFYFFSQYTKQWNLGMAGLTIAILPVVIFYFL
LACG_RHIRD      MRSTYAAAFVIVFMLNWNNYLWPLIVLQSNDTKTITLVVSSLASAYSPEYGTVMIGTILATLPTLLVFFA
YOR2_CALSR      SAPALITVGIYNGTYLWNEFVFALVLTSSPTRRTLPLGIWDFQARYGSDIPAIMAFLTLSLLPMLIAYIF
UGPE_SALTI      SKTNLAALFVITFIYGWNQYLWPLLIITDVNLGTAVAGIKGMIGEGTTQWNQVMAAMXXXXXXXXXXXXA
UGPE_SALTY      SKTNLAALFVITFIYGWNQYLWPLLIITDVNLGTAVAGIKGMIGEGTTQWNQVMAAMXXXXXXXXXXXXA
UGPE_SALPA      SKTNLAALFVITFIYGWNQYLWPLLIITDVNLGTAVAGIKGMIGEGTTQWNQVMAAMXXXXXXXXXXXXA
UGPE_SALCH      SKTNLAALFVITFIYGWNQYLWPLLIITDVNLGTAVAGIKGMIGEGTTQWNQVMAAMXXXXXXXXXXXXA
UGPE_BRUME      SKTNIAALFVILFIYGWTQYLWPLLVTNDAKMNTIIIGLRRMVDDASTPWNYVMVTXXXXXXXXXXXXXX
UGPE_ERWCT      SKTNLAALFVITFIYGWNQYLWPLLIVSDANLGTAVAGIKSMIASGDTQWNQXXXXXXXXXXXXXXXXXX
UGPE_BRUAB      SKTNIAALFVILFIYGWTQYLWPLLVTNDAKMNTIIIGLRRMVDPWNYVMXXXXXXXXXXXXXXXXM---
UGPE_BRUA2      SKTNIAALFVILFIYGWTQYLWPLLVTNDAKMNTIIIGLRRMVDPWNYVMXXXXXXXXXXXXXXXXM---
Y1216_PYRHO     SKAPFVVTGIYQFTNIWNDYLFGVVLTRGEEAMPATVKLANLKGSFVANWNIQMAGALIVALPTLLIMIA
UGPE_BRUSU      SKTNIAALFVILSIYGWTQYLWPLLVTNDAKMNTIIIGLRRMVDDASTSWNYVMVTXXXXXXXXXXXXXX
UGPE_YERPS      SKTNLAALFVITFIYGWNQYLWPILITSDASMGTAVAGIRSMISTSGTQWNQVMAAMXXXXXXXXXXXXX
UGPE_YERPN      SKTNLAALFVITFIYGWNQYLWPILITSDASMGTAVAGIRSMISTSGTQWNQVMAAMXXXXXXXXXXXXX
UGPE_YERPE      SKTNLAALFVITFIYGWNQYLWPILITSDASMGTAVAGIRSMISTSGTQWNQVMAAMXXXXXXXXXXXXX
UGPE_YERPA      SKTNLAALFVITFIYGWNQYLWPILITSDASMGTAVAGIRSMISTSGTQWNQVMAAMXXXXXXXXXXXXX
YTCP_BACSU      SLPAIATISLFYAVTYWNTYMTAILYLNDSAKWPIQVLLRQIVIVSSGMQGDMSAVIVVATIPVLLVYPF
UGPE_RHIME      SKTNIAALFVILFIYGWTQYLWPLLVTNDSRMNTIIIGLRKMVDDASTPWNYVMVTXXXXXXXXXXXXXX
UGPE_SHIF8      SKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIGEGTTEWNSVMAAMXXXXXXXXXXXXX
UGPE_SHIFL      SKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIGEGTTEWNSVMAAMXXXXXXXXXXXXX
UGPE_ECOUT      SKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIGEGTTEWNSVMAAMXXXXXXXXXXXXX
UGPE_ECOL6      SKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIGEGTTEWNSVMAAMXXXXXXXXXXXXX
UGPE_ECOL5      SKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIGEGTTEWNSVMAAMXXXXXXXXXXXXX
UGPE_ECOK1      SKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIGEGTTEWNSVMAAMXXXXXXXXXXXXX
UGPE_ECO57      SKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIGEGTTEWNSVMAAMXXXXXXXXXXXXX
UGPE_ECOLI      SKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIK------------------------------
YOE1_STRAT      LAPGIAATALFAFVTAWNEFFFALVLLKSPHRQTLPVVLTHFIGAEGVPTSPAGAAAFLATLPSLAFFAL
POTC_SHIFL      AMPAVAAGWVLSFTLSMDDVVVSSFV--------------------------------------------
POTC_ECOLI      AMPAVAAGWVLSFTLSMDDVVVSSFV--------------------------------------------
POTC_ECOL6      AMPAVAAGWVLSFTLSMDDVVVSSFV--------------------------------------------
POTC_ECO57      AMPAVAAGWVLSFTLSMDDVVVSSFV--------------------------------------------
WTPB_ARCFU      SVRHIVAGAIMSWARGISE---------------------------------FGAVVVIAYYPMIAPTLI
UGPE_SHIDS      SKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIGEGTTEWNSVMAAMXXXXXXXXXXXXX
FBPB2_HAEIN     LKPAIGSSILLIALHMLVEFGAVSIL--NYQTFTTAIFQEYEMSFNN------STAALLSAVLMAICILI
LPLC_BACSU      SKPVIATFALFYAVGIWNDFFHALLYINDSAKWPLQMVLRQVTTMQNAVQGIKLAVIVIATLPILAVYPF
MSMF_STRMU      LLPSISMVFIMALKAGLTAFQIFALTGGGPNNSTTSLGLLVY----------------------------
WTPB_PYRKO      AFPSIASGAIMTWARAISE--VGAILIVAYYPKTAQVLILEYFN--NYLRASRPIAVIMVSLSLGIFVIL
CYST_ZYGCR      MISPLLTGTALGFSRAIGEYGSIVLVASNIPMKDLVVSVLIFQRLEQY---DYKGATAIASVVLLVSFAI
YCJO_SHIFL      IMPVLATVVTLRTI--------------------------------------------------------
YCJO_ECOLI      IMPVLATVVTLRTI--------------------------------------------------------
CYSW_ECOLI      IRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIELLEQDY----------------------
CYSW_ECOL6      IRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIELLEQDY----------------------
MODB_HAEIN      SLPGVLAGLVLGFARSLGEFGATITFVSNIAGETQTIPLAMY----------------------------
MSMG_STRMU      LKPMHATTLIINALWFWNDFMLPLLILKDSSMWTLPLFQYNYSGQYFNDYGPSFASXXXXXXXXXXXXXX
CYST_MESVI      LIPSLLTGIALAFSRAVGEYGSVVIIASNIPFKDLTAPVLIFQKLEQY---DYTGATVIGTVILSILFIL
CYSW_SYNE7      IKWSMLYGVVLTTARALGEFGAVSVVSGSITGKTQTLPLEAYKQYQTTL--SYTAALLLGGISLVTLVLK
CYST_SALTY      LSPALIAGVALSFTRSLGEFGAVIFIATEVTSLMIFVRLQEFDYP-------------------------
CYST_CHLVU      LWPALFTGFTLSFSRALGEFGSIVMISSNLPFKDLVASVLIYQSLEQY---DYLGASVI-----------
CYST_PROWI      LVPALVTGFTLSFSRALGEFGSVVMISSNLPLDDLVTSVLIYQSLEQY---DYFGASVIGAV--------
Y2990_BRUA2     LKPFVNIAIVLNTIYVFNSFPIIWVMTRPANSTDILV---THLYKLAFRLGKFGEASAVSLIMLAILLV-
Y2783_BRUAB     LKPFVNIAIVLNTIYVFNSFPIIWVMTRPANSTDILV---THLYKLAFRLGKFGEASAVSLIMLAILLV-
CYST_CHLAT      LTPAIVTGVALAFSRAIGE---------------------------------------------------
POTC_HAEIN      ALPAVVSGWLLSF---------------------------------------------------------
MODB_ECOLI      TLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRTIPSAMY----------------------------
MODB_ECO57      TLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRTIPSAMY----------------------------
CYST_HELSJ      ILPAILNGFTLTFSRSLSEMVAGNLPLQDLVSSVL---ISQYLEQYDYI---------------------
YDCU_ECOLI      AIPGIAAGSIFTFSLTLGDFIVPQL----VGPPGYFIGNMVY--SQQGAIGNMPMAAAFTLVPIILIAL-
Y3749_BRUSU     LKPFVNIAIVLNTIYVFNSFPIIWVMTQPANSTDILV---THLYKLAFRLGKLGEASAVSLIMLAILLV-
CYST_NEPOL      LMPAMMTGIALAFSRAVGE---------------------------------------------------
AMYD_THETU      IAPAFTVSLFIT----------------------------------------------------------
POTI_ECOLI      IMPAIISGWLLAFTLSLDDLVIASFV--------------------------------------------
POTI_ECOL6      IMPAIISGWLLAFTLSLDDLVIASFV--------------------------------------------
MALF_YERPE      LIKPLTPLMIASF---------------------------------------------------------
POTH_ECOLI      TKGGIIAGSMLVFIPAVGEFVIPELL--------------------------------------------
CYST_ANTFO      XXXXXXXGTALGFSRAIGEYGSIVLIACNIPMKDLVISVLIFQKLEQY---DYQGAIVVATIVLIASF--
MALC_STRR6      ILAVAAPTLISQY---------------------------------------------------------
MALC_STRPN      ILAVAAPTLISQY---------------------------------------------------------
MALF_PHOLL      LIKPLTPLMIASFAFNFNNFVLIQLLTPDRIGTTTPAGYTDLLVSYTYRIADFGLAAAIA----TVIFLL
YVGM_BACSU      AYPSLLTGSILSLARALGE---------------------------------------------------
Y4OQ_RHISN      LVPYIMIAAAFRIIGVMADFDKIFLL--------------------------------------------
WTPB_PYRAB      ALPSIASGAIMAWARGISE--VGAILIVAYYPKTAQVLVMEYFN--NYLRASRPISVILMGISLGIFVVL
YQGH_BACSU      AFPTLMTAVVLGMARAFGEALAVQMVIGNTTIITLNMGHTTYGSVENTLWSMGLVLLVMSFLFILLIRYL
POTB_SHIFL      TMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDWPFG----AATSITLTIVMGLML
POTB_HAEIN      TMPGIIAGCLLVLLPAMGMFYVADLL---GGAKVLLVGKSEFLISRNWPFG----SAVSIGLTVLMALLI
POTB_ECOLI      TMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDWPFG----AATSITLTIVMGLML
CYSW_SYNY3      ----------------------------------------------------------------------
CYST_MARPO      XXXXXXXXXXXXXXRALGEYGSIVLIASNIPMKDLVISVLLFQKLEQY---DYKSATIIASFVLIISF--
POTB_SALTY      TMPGIVAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDWPFG----AATSITLTIVMGLML
POTB_SALTI      TMPGIVAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDWPFG----AATSITLTIVMGLML
Y4FN_RHISN      VAPTAILVAGMKFNNLLAEYPL-SAFLYNVNNKPLPIAI-------------------------------
CYST_ECOLI      LSPALVAGVALSFTRSLGEFGAVIFIATEVTSLMIFVRLQEFDYP-------------------------
Y189_MYCGE      VKSTSWTVGILTAFSAWNSYLWPLLLLLNINLWVLQQGILDANSSDEQLLNLKMSAAILAILPMFIIYFL
FBPB1_HAEIN     LRPALANSFLIVFIQSLAD--FSNPLVLGGSFDVIATQIYFYIAGSQL---DYASASTLGSMLLIFIFII
YECS_SHIFL      AARVALPPLSNSFISLVKDTSLAATI--------------------------------------------
YECS_ECOLI      AARVALPPLSNSFISLVKDTSLAATI--------------------------------------------
YECS_ECOL6      AARVALPPLSNSFISLVKDTSLAATI--------------------------------------------
Y136_MYCPN      VRSTTWTVSILTAFAAWNSYLWPLLLLTNINLWVLAQGTDQSDEQIRVLLNLKMAAAILAILPMFIVYFL
WTPB_PYRHO      ALPSIASGGIMAWARSMSE--VGAILIVAYYPKTAQILVMEYFN--NYGLRASRPISVMLML-ISLSIFV
UGPA_SHIFL      IAPVSFFLLVVNLVYA------------------------------------------------------
UGPA_SHIF8      IAPVSFFLLVVNLVYA------------------------------------------------------
UGPA_ECOUT      IAPVSFFLLVVNLVYA------------------------------------------------------
UGPA_ECOLI      IAPVSFFLLVVNLVYA------------------------------------------------------
UGPA_ECOL6      IAPVSFFLLVVNLVYA------------------------------------------------------
UGPA_ECOL5      IAPVSFFLLVVNLVYA------------------------------------------------------
UGPA_ECOK1      IAPVSFFLLVVNLVYA------------------------------------------------------
UGPA_ECO57      IAPVSFFLLVVNLVYA------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AQRWLVNGLTAGGVKG
MALG_SHIFL      AQRWLVNGLTAGGVKG
MALG_ECOLI      AQRWLVNGLTAGGVKG
MALG_ECOL6      AQRWLVNGLTAGGVKG
MALG_ECO57      AQRWLVNGLTAGGVKG
MALG_SALTY      AQRWLVNGLTAGGVKG
MALG_SALTI      AQRWLVNGLTAGGVKG
MALG_ENTAE      AQRWLVNGLTAGGVKG
MALG_PHOLL      AQRWLVSGLTAGGVKG
MALG_YERPE      AQRWLVGGLTAGGVKG
MALG_VIBVY      AQRWLVGGLTAGGVKG
MALG_VIBVU      AQRWLVGGLTAGGVKG
MALG_VIBCH      AQRWLVGGLTAGGVKG
MALG_VIBPA      AQRWLVGGLTAGGVKG
GANQ_BACSU      LQKNFVSGLTAGGTKG
MALD_STRR6      LQKNFVSGLTSGGDKG
MALD_STRPN      LQKNFVSGLTSGGDKG
YCJP_ECOLI      SERFIKSGLTAGGVKG
MDXG_BACSU      LQKNFVSGLTAGGTKG
YURM_BACSU      MQKYFVRGIASGSVKG
YESQ_BACSU      FQKYIVQGISTTGLK-
YJ16_PYRHO      FQKYYISGMIGWSVE-
Y4OR_RHISN      MQRYLVQGLTMGSVK-
UGPE_AGRT5      MQRWFVKGL-------
UGPE_YERE8      MQRWFVRGL-------
AGLG_RHIME      LQRYLVRGLLAGSVKG
ARAQ_BACHD      FQRYFIAGLTVGGVKG
ARAQ_BACSU      FQKYFISGLTVGGVKG
AMYC_THETU      AQRKLVTAIIAGAVK-
LACG_RHIRD      MQRQFVQGM-LGSVK-
YOR2_CALSR      GQDKIIKGMMAGAVKG
UGPE_SALTI      MQRAFVRGL-------
UGPE_SALTY      MQRAFVRGL-------
UGPE_SALPA      MQRAFVRGL-------
UGPE_SALCH      MQRAFVRGL-------
UGPE_BRUME      MQRWFVKGL-------
UGPE_ERWCT      XQRWFVRGL-------
UGPE_BRUAB      -QRWFVKGL-------
UGPE_BRUA2      -QRWFVKGL-------
Y1216_PYRHO     LGKYLIRGYTSGALKG
UGPE_BRUSU      MQRWFVKGL-------
UGPE_YERPS      MQRWFVRGL-------
UGPE_YERPN      MQRWFVRGL-------
UGPE_YERPE      MQRWFVRGL-------
UGPE_YERPA      MQRWFVRGL-------
YTCP_BACSU      IQKHFAKGALLGSVKG
UGPE_RHIME      MQRWFVKGL-------
UGPE_SHIF8      MQRAFVRGL-------
UGPE_SHIFL      MQRAFVRGL-------
UGPE_ECOUT      MQRAFVRGL-------
UGPE_ECOL6      MQRAFVRGL-------
UGPE_ECOL5      MQRAFVRGL-------
UGPE_ECOK1      MQRAFVRGL-------
UGPE_ECO57      MQRAFVRGL-------
UGPE_ECOLI      ----------------
YOE1_STRAT      VQRRITSGLLTGAVK-
POTC_SHIFL      ----------------
POTC_ECOLI      ----------------
POTC_ECOL6      ----------------
POTC_ECO57      ----------------
WTPB_ARCFU      YERYLSEGLSA-----
UGPE_SHIDS      MQRAFVRGL-------
FBPB2_HAEIN     ----------------
LPLC_BACSU      LQKHFAKGMLIGSVKG
MSMF_STRMU      ----------------
WTPB_PYRKO      --RWLV----------
CYST_ZYGCR      ----------------
YCJO_SHIFL      ----------------
YCJO_ECOLI      ----------------
CYSW_ECOLI      ----------------
CYSW_ECOL6      ----------------
MODB_HAEIN      ----------------
MSMG_STRMU      FQKHIIAGMSNGAVK-
CYST_MESVI      ----------------
CYSW_SYNE7      A---------------
CYST_SALTY      ----------------
CYST_CHLVU      ----------------
CYST_PROWI      ----------------
Y2990_BRUA2     ----------------
Y2783_BRUAB     ----------------
CYST_CHLAT      ----------------
POTC_HAEIN      ----------------
MODB_ECOLI      ----------------
MODB_ECO57      ----------------
CYST_HELSJ      ----------------
YDCU_ECOLI      ----------------
Y3749_BRUSU     ----------------
CYST_NEPOL      ----------------
AMYD_THETU      ----------------
POTI_ECOLI      ----------------
POTI_ECOL6      ----------------
MALF_YERPE      ----------------
POTH_ECOLI      ----------------
CYST_ANTFO      ----------------
MALC_STRR6      ----------------
MALC_STRPN      ----------------
MALF_PHOLL      VGALAVINLKATRIK-
YVGM_BACSU      ----------------
Y4OQ_RHISN      ----------------
WTPB_PYRAB      --RWLI----------
YQGH_BACSU      SSR-------------
POTB_SHIFL      LVYWRASRL-------
POTB_HAEIN      FVYYRANKL-------
POTB_ECOLI      LVYWRASRL-------
CYSW_SYNY3      ----------------
CYST_MARPO      ----------------
POTB_SALTY      LIYWRASRL-------
POTB_SALTI      LIYWRASRL-------
Y4FN_RHISN      ----------------
CYST_ECOLI      ----------------
Y189_MYCGE      FHKRIMNAIRANTIKG
FBPB1_HAEIN     QYIWIGN---------
YECS_SHIFL      ----------------
YECS_ECOLI      ----------------
YECS_ECOL6      ----------------
Y136_MYCPN      FRKRIMKGSRANTIKG
WTPB_PYRHO      FLRWLI----------
UGPA_SHIFL      ----------------
UGPA_SHIF8      ----------------
UGPA_ECOUT      ----------------
UGPA_ECOLI      ----------------
UGPA_ECOL6      ----------------
UGPA_ECOL5      ----------------
UGPA_ECOK1      ----------------
UGPA_ECO57      ----------------