[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for ecol0:AAC77012.1

[Show Plain Result]


## Summary of Sequence Search
    1::122
    1::122     8e-59 100%  122 aa  KDGL_SHIFL RecName: Full=Diacylglycerol kinase;         Short=DAGK;
    1::122     8e-59 100%  122 aa  KDGL_ECOLI RecName: Full=Diacylglycerol kinase;         Short=DAGK;
    1::122     8e-59 100%  122 aa  KDGL_ECOL6 RecName: Full=Diacylglycerol kinase;         Short=DAGK;
    1::122     8e-59 100%  122 aa  KDGL_ECO57 RecName: Full=Diacylglycerol kinase;         Short=DAGK;
    4::98      6e-23  53%  118 aa  KDGL_HAEIN RecName: Full=Diacylglycerol kinase;       
   10::121     2e-20  46%  123 aa  KDGL_PSEAE RecName: Full=Diacylglycerol kinase;         Short=DAGK;
   12::104     1e-18  46%  128 aa  KDGL_HELPY RecName: Full=Diacylglycerol kinase;         Short=DAGK;
   12::104     5e-18  44%  128 aa  KDGL_HELPJ RecName: Full=Diacylglycerol kinase;         Short=DAGK;
   65::145     1e-10  39%  175 aa  KDGL_SYNY3 RecName: Full=Probable diacylglycerol kinase;       
   26::109     8e-09  39%  137 aa  UDPK_STRMU RecName: Full=Undecaprenol kinase;         Short=UdpK;  
   20::112     8e-09  34%  137 aa  KDGL_PSEDE RecName: Full=Diacylglycerol kinase;         Short=DAGK;
   21::112     1e-08  34%  137 aa  KDGL_RHIME RecName: Full=Diacylglycerol kinase;         Short=DAGK;
    1::122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVE
KDGL_SHIFL      MANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVE
KDGL_ECOLI      MANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVE
KDGL_ECOL6      MANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVE
KDGL_ECO57      MANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVE
KDGL_HAEIN      ----TTGLTHLINSTKYSLQGLKSAFKNETAFRHECFLACILIPLTFFLGETKIEIILMISSVLLVMALE
KDGL_PSEAE      -----TGLKRILNATGYSLAGFLAAFRGEAAFRQLVLLNVVLIPVAFLLDVSRGERALMIAVCLLALIVE
KDGL_HELPY      ------GFKRLFKALFYSKDGLKCAWIEESAFRQIVILALFCIVLASYLAKDFLEWGLLILPCFLSVVVE
KDGL_HELPJ      ------GFKRLFKALFYSKDGLKCAWAEESAFRQIVILALFCIVLASYLTKDFLEWGLLILPCFLSVVIE
KDGL_SYNY3      ----------------YAWAGVSYAFATQRNFRIHTFTGVAVITAASLLHLEAIAVAVLALTSCLVMILE
UDPK_STRMU      ----------------FALTGIFTAFKEERNMKKHAVSALLAVIAGLVFKVSVIEWLFLLLSIFLVITFE
KDGL_PSEDE      -----TGIRHLFAAASYSLGGAKRL-IGEAAFRHELXXXXXXXXXXXXVGATFFQYVAMAILFLLMMAFE
KDGL_RHIME      ------GIRHLFAAASYSFGGAKRL-IGEAAFRHELXXXXXXXXXXXXXGANLFQYVAMAILFLLMMAFE


                         .         .         *         .         .         .         .:140
query           ILNSAIEAVVDRIGSEYHELSGRAKDMGSXXXXXXXXXXXXTWCILLWSHFG
KDGL_SHIFL      ILNSAIEAVVDRIGSEYHELSGRAKDMGSXXXXXXXXXXXXTWCILLWSHFG
KDGL_ECOLI      ILNSAIEAVVDRIGSEYHELSGRAKDMGSXXXXXXXXXXXXTWCILLWSHFG
KDGL_ECOL6      ILNSAIEAVVDRIGSEYHELSGRAKDMGSXXXXXXXXXXXXTWCILLWSHFG
KDGL_ECO57      ILNSAIEAVVDRIGSEYHELSGRAKDMGSXXXXXXXXXXXXTWCILLWSHFG
KDGL_HAEIN      LLNSAVETVVDRIGTERHELSGRAKDQGS-----------------------
KDGL_PSEAE      LLNSAIEATVDRVSLERHPLSKNAKDMGSAAQFVALTVITVTWATIL-----
KDGL_HELPY      LINSSIEKAVDFTGTEFHPLAKKAKDMAS-----------------------
KDGL_HELPJ      LINSSIEKAVDFTGTEFHPLAKKAKDMAS-----------------------
KDGL_SYNY3      LLNTALESVVDTVGQSYHELAKIAKD--------------------------
UDPK_STRMU      IVNSAIENVVD-LASDYHMLAKNAKDMAA-----------------------
KDGL_PSEDE      AINTAIEEIVDRVSPEISEMGKNAKDLGS-----------------------
KDGL_RHIME      AINTAIEEIVDRVSPEISEMGRNAKDLGS-----------------------