[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ecol0:AAC73143.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a9xB.bssp"
#ERROR : Can't open dsspfile "1cs0B.bssp"
#ERROR : Can't open dsspfile "1bxrB.bssp"
#ERROR : Can't open dsspfile "1c30B.bssp"
#ERROR : Can't open dsspfile "3bgyB.bssp"
#ERROR : Can't open dsspfile "1cf9A.bssp"
#ERROR : Can't open dsspfile "2a9vB.bssp"
#ERROR : Can't open dsspfile "2a9vC.bssp"
#ERROR : Can't open dsspfile "2a9vA.bssp"
#ERROR : Can't open dsspfile "2an1C.bssp"
#ERROR : Can't open dsspfile "2d7jA.bssp"
#ERROR : Can't open dsspfile "3efeB.bssp"
#ERROR : Can't open dsspfile "2a9vD.bssp"
#ERROR : Can't open dsspfile "3efeF.bssp"
#ERROR : Can't open dsspfile "3d54D.bssp"
#ERROR : Can't open dsspfile "2abwA.bssp"
#ERROR : Can't open dsspfile "3dkyE.bssp"
#ERROR : Can't open dsspfile "2abwB.bssp"
#ERROR : Can't open dsspfile "3efeD.bssp"
#ERROR : Can't open dsspfile "3efeC.bssp"
#ERROR : Can't open dsspfile "2an1D.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "3cy6A.bssp"
#ERROR : Can't open dsspfile "3efeA.bssp"
#ERROR : Can't open dsspfile "1aa7B.bssp"
#ERROR : Can't open dsspfile "3cz9A.bssp"
#ERROR : Can't open dsspfile "3b38A.bssp"
#ERROR : Can't open dsspfile "3b3aA.bssp"
#ERROR : Can't open dsspfile "3czaA.bssp"
#ERROR : Can't open dsspfile "3b36A.bssp"
#ERROR : Can't open dsspfile "1c4fA.bssp"
#ERROR : Can't open dsspfile "2ab0A.bssp"
#ERROR : Can't open dsspfile "2dufA.bssp"
#ERROR : Can't open dsspfile "2an1B.bssp"
#ERROR : Can't open dsspfile "3bweE.bssp"
#ERROR : Can't open dsspfile "3bweD.bssp"
#ERROR : Can't open dsspfile "2c5sA.bssp"
#ERROR : Can't open dsspfile "2ahaA.bssp"
#ERROR : Can't open dsspfile "2abrB.bssp"
#ERROR : Can't open dsspfile "1bfpA.bssp"

## Summary of PDB Search
:382
    e-117  95%  1a9xB  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL
    e-117  98%  1cs0B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    e-112 100%  1bxrB  [c.8.3 - c.23.16] CARBAMOYL-PHOSPHATE SYNTHASE
    e-111 100%  1c30B  [c.8.3 - c.23.16] CARBAMOYL PHOSPHATE SYNTHETASE: SMALL
    4e-48   9%  3bgyB  [x.x.x] POLYNUCLEOTIDE 5'-TRIPHOSPHATASE
    2e-43  11%  1cf9A  [e.5.1 - c.23.16] PROTEIN (CATALASE HPII)
    1e-37  26%  2a9vB  [x.x.x] GMP SYNTHASE
    7e-37  25%  2a9vC  [x.x.x] GMP SYNTHASE
    2e-36  25%  2a9vA  [x.x.x] GMP SYNTHASE
    3e-36  10%  2an1C  [x.x.x] PUTATIVE KINASE
    2e-34  24%  2d7jA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    5e-34  14%  3efeB  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    7e-34  24%  2a9vD  [x.x.x] GMP SYNTHASE
    4e-33  11%  3efeF  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    5e-32  17%  3d54D  [x.x.x] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE 1
    7e-31  13%  2abwA  [x.x.x] PDX2 PROTEIN
    1e-30  11%  3dkyE  [x.x.x] REPLICATION PROTEIN REPB
    1e-30  17%  2abwB  [x.x.x] PDX2 PROTEIN
    1e-28  13%  3efeD  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    4e-28  10%  3efeC  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    7e-28  13%  2an1D  [x.x.x] PUTATIVE KINASE
    4e-27  20%  1aa7A  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
    1e-26  13%  3cy6A  [x.x.x] PROTEIN DJ-1
    9e-25  12%  3efeA  [x.x.x] THIJ/PFPI FAMILY PROTEIN
    4e-24  19%  1aa7B  [a.95.1] INFLUENZA VIRUS MATRIX PROTEIN
    8e-24  13%  3cz9A  [x.x.x] PROTEIN DJ-1
    2e-23  15%  3b38A  [x.x.x] PROTEIN DJ-1
    5e-23  15%  3b3aA  [x.x.x] PROTEIN DJ-1
    7e-23  13%  3czaA  [x.x.x] PROTEIN DJ-1
    3e-22  14%  3b36A  [x.x.x] PROTEIN DJ-1
    6e-22  13%  1c4fA  [d.22.1] GREEN FLUORESCENT PROTEIN
    4e-21  15%  2ab0A  [x.x.x] YAJL
    4e-21  12%  2dufA  [x.x.x] GREEN FLUORESCENT PROTEIN
    5e-21  12%  2an1B  [x.x.x] PUTATIVE KINASE
    7e-20  12%  3bweE  [x.x.x] PROTEIN DJ-1
    4e-18  12%  3bweD  [x.x.x] PROTEIN DJ-1
    9e-18   9%  2c5sA  [x.x.x] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII
    1e-09  14%  2ahaA  [x.x.x] GREEN FLUORESCENT PROTEIN
    5e-07   7%  2abrB  [x.x.x] ARGININE DEIMINASE
    6e-06  15%  1bfpA  [x.x.x] BLUE FLUORESCENT PROTEIN
:382

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1a9xB           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1cs0B           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1bxrB           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1c30B           -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
3bgyB           ----------------------------------------------------------------------
1cf9A           --------------------------------------YQERVEGNKVRERSP----SFGEYYSHPRLFW
2a9vB           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3dkyE           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3efeA           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3b36A           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2ab0A           ----------------------------------------------------------------------
2dufA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
2c5sA           ----------------------------------------------------------------------
2ahaA           ----------------------------------------------------------------------
2abrB           ----------------------------------------------------------------------
1bfpA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1a9xB           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1cs0B           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1bxrB           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1c30B           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
3bgyB           -------------------------------------------------FSENEYNEIVEMLRDYSNGDN
1cf9A           LSQTPFEQRHIVFELSKVVRPYIRERVVDQLAHIDL--TLAQAVAKNLGIELTDDQLNITPPPD-VNGLK
2a9vB           ----------------------------------------------------------------------
2a9vC           ----------------------------------------------------------------------
2a9vA           ----------------------------------------------------------------------
2an1C           ----------------------------------------------------------------------
2d7jA           ----------------------------------------------------------------------
3efeB           ----------------------------------------------------------------------
2a9vD           ----------------------------------------------------------------------
3efeF           ----------------------------------------------------------------------
3d54D           ----------------------------------------------------------------------
2abwA           ----------------------------------------------------------------------
3dkyE           ----------------------------------------------------------------------
2abwB           ----------------------------------------------------------------------
3efeD           ----------------------------------------------------------------------
3efeC           ----------------------------------------------------------------------
2an1D           ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
3cy6A           ----------------------------------------------------------------------
3efeA           ----------------------------------------------------------------------
1aa7B           ----------------------------------------------------------------------
3cz9A           ----------------------------------------------------------------------
3b38A           ----------------------------------------------------------------------
3b3aA           ----------------------------------------------------------------------
3czaA           ----------------------------------------------------------------------
3b36A           ----------------------------------------------------------------------
1c4fA           ----------------------------------------------------------------------
2ab0A           ----------------------------------------------------------------------
2dufA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------------------------
3bweE           ----------------------------------------------------------------------
3bweD           ----------------------------------------------------------------------
2c5sA           ----------------------------------------------------------------------
2ahaA           ----------------------------------------------------------------------
2abrB           ----------------------------------------------------------------------
1bfpA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
1a9xB           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGAKRNILRMLV
1cs0B           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
1bxrB           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGAKRNILRMLV
1c30B           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
3bgyB           L------EFEVSFKNINYPNFMRITEHYINITPENKI--------------ESNNYLDISLIFPDKNVYR
1cf9A           KDPSLSLYAIPDGDVKGRVVAILLNDEVRSAD----LLAILKALKAKG---VHAK--LLYSRMGEVT---
2a9vB           -----------------------------------------------------IYVVDNGGQHREWRVLR
2a9vC           ----------------------------------------------------KIYVVDNGGQHREWRVLR
2a9vA           --------------------------------------------------HLKIYVVDNGGQHREWRVLR
2an1C           ----------------------------------------------------CIGIVGHTTHEMLYRWLC
2d7jA           -----------------------------------------------------IVIMDNGGQHRIWRTLR
3efeB           ---------------------------------------------------FKKDLAPLKVITVGANKEM
2a9vD           --------------------------------------------------HLKIYVVDNGGQHREWRVLR
3efeF           ---------------------------------------------------FKKDLAPLKVITVGANKEM
3d54D           -----------------------------------------------------VVYPGSNCDRDAYHALE
2abwA           -----------------------------------------------------IGVLSLQGDFNHFIKLQ
3dkyE           --------------------------------------------------YFTFLLYPESIPSDWELPLH
2abwB           ------------------------------------------------EITIGVLSLQGDFEPHINHFIK
3efeD           ---------------------------------------------------FKKDLAPLKVITVGANKEM
3efeC           ----------------------------------------------------KKDLAPLKVITVGANKEM
2an1D           -----------------------------------------------------------GTHEMLYRWLC
1aa7A           ---------------MSLLTEVETYVLS-IIPSG--------PLKAEIAQRLEDVFAGKNTDLEVLMEWL
3cy6A           ---------------------------------------------------MRRAGIKVTVAGLAGKDPV
3efeA           ---------------------------------------------------FKKDLAPLKVITVGANKEM
1aa7B           ---------------------LTEVETYVLSIIPSG------PLKAEIAQRLEDVFAGKNTDLEVLMEWL
3cz9A           ---------------------------------------------------MRRAGIKVTVAGLAGKDPV
3b38A           ---------------------------------------------------MRRAGIKVTVAGLAGKDPV
3b3aA           ---------------------------------------------------MRRAGIKVTVAGLAGKDPV
3czaA           ---------------------------------------------------MRRAGIKVTVAGLAGKDPV
3b36A           ---------------------------------------------------LRRAGIKVTVAGLAGKDPV
1c4fA           ----------------------------------------------------------------------
2ab0A           --------------------------------------------------KVTTASVASDGNLAI-----
2dufA           ----------------------------------------------------------------------
2an1B           ----------------------------------------------------CIGIVGHTTHEMLYRWLC
3bweE           ----------------------------------------------------TVAGLAGKDPVQ------
3bweD           ----------------------------------------------------TVAGLAGKDPVQ------
2c5sA           ----------------------------------------------------------------------
2ahaA           ----------------------------------------------------------------------
2abrB           -----------------------------------------------------------CSPGLAHQRLT
1bfpA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
1a9xB           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAI-TAIQKFLETDIPVFGILGHQLLALASG
1cs0B           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLE-TDIPVFGILGHQLLALASG
1bxrB           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
1c30B           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGISLGHQLLALASG
3bgyB           VSLFNQEQIGEFITKFSKASNDISRYIVSLDPSDDIEIVY-----------KNRGSGKLIGIDNWAITIK
1cf9A           --ADDGTVLPIAATFAGAPSLTVDAVIVPCGNIADIADNDANYYLMEAYKHLKPIALAGDARKFKATIKI
2a9vB           ELGVDTKIVPNDIDSSELDGL--DGLVLSGAPNIDEELDKLGSVGKYIDDHNYPILGICVGAQFIALHFG
2a9vC           ELGVDTKIVPNDIDSSELDGL--DGLVLSGAPNIDEELDKLGSVGKYIDDHNYPILGICVGAQFIALHFG
2a9vA           ELGVDTKIVPNDIDSSELDGL--DGLVLSGAPNIDEELDKLGSVGKYIDDHNYPILGICVGAQFIALHFG
2an1C           DQGYEVIVEQQIAHELQVPTGTAEIGQQADLAVVVGGDGNMLGAARTLARYDINVIGINRGNLGFLTDLD
2d7jA           YLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGN-CEKVLEHYDEFNVPILGICLGHQLIAKFFG
3efeB           ITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHPILERIGQALKIGTIVAAICGATDALANMGY
2a9vD           ELGVDTKIVPNDIDSSELDGL--DGLVLSGAPNIDEELDKLGSVGKYIDDHNYPILGICVGAQFIALHFG
3efeF           ITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQILERIGQALKIGTIVAAICGATDALANMGY
3d54D           INGFEPSYVGLDDKLDD-----YELIILPGGFSYGDYLRPGAVAIAKAAERGKLIMGINGFQILIEMGLL
2abwA           IPSLNIIQVRNVHDLGL-----CDGLVIPGGESTTVRRCCAYELVHFIHVLKKPIWGTCAGCILLSKNVE
3dkyE           DKDHYHVLVTADSVRKKIKLLLGVQVVLNVENMYLYLTHESKDAIAKKKHV-YDKADIKLINNIDRYVTL
2abwB           LQIPSLNIIQVR---NVHDLGLCDGLVIPGGESTTVRRCCAYELVHFIHVLKKPIWGTCAGCILLSKNVE
3efeD           ITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHPILERIGQALKIGTIVAAICGATDALANMGY
3efeC           ITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIHQILERIGQALKIGTIVAAICGATDALANM-G
2an1D           DQGYEVIVEKVPTGTLAEIGQQADLAVVVGGDGNM------LGAARTLARYDINVIGINRGNLGFLTDLD
1aa7A           KTRPILSPLTFTLTVPSERGLQRRRFVQNNGNGDPNNMDKALYRKLKREITFHGAKEISLSYSAGALASC
3cy6A           QCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSAVKEILKEQENRKGLIAAICAGPTALLAHEI
3efeA           ITTMGGLRIKPDISLDECTLESKDLLILPGGTTWSEEIQPILERIGQALKIGTIVAAICGATDALANMGY
1aa7B           KTRPILSPLTFTLTVPSERGLQRRRFVQNNGNGDPNNMDKAVKLYRKLKRTFHGAKEISLSYSAGALASC
3cz9A           QCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSEVKEILKEQENRKGLIAAICAGPTALLAHEI
3b38A           QCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSAVKEILKEQENRKGLIAVICAGPTALLAHEI
3b3aA           QCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSEVKEILKEQENRKGLIAAICAGPTALLAHEI
3czaA           QCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSAVKEILKEQENRKGLIAAICAGPTALLAHEI
3b36A           QCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLAAVKEILKEQENRKGLIAAICAGPTALLAHTT
1c4fA           ------------------------------------------------------------GEELFTGVVP
2ab0A           -TCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGARDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHD
2dufA           -----------------------------------------------------------KGEELFTGVVP
2an1B           DQGYEVIVEQVPTGTLAEIGQQADLAVVVGGDGNM------LGAARTLARYDINVIGINRGNLGFLTDLD
3bweE           -CSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGASESAAVKEILKEQENRKGLIAAICAGPTALLAHEI
3bweD           -CSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGASESAAVKEILKEQENRKGLIAAICAGPTALLAHEI
2c5sA           -----------------------------------------------------EYILVRYGESKFVSTLK
2ahaA           -----------------------------------------------------------KGEELFT----
2abrB           PSNCDELLFD---DVIWVNQADFVTKMRERGIDVLEMHNLLTEILDRKIADSVGLGLTSELRSWLESLEP
1bfpA           -----------------------------------------------------------KGEELFT----


                         .         *         .         .         .         .         +:350
query           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1a9xB           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1cs0B           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1bxrB           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1c30B           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
3bgyB           STEEIPLVAGSKISKPKITGSERIMYRYKTRYSFTINK--------NSRIDITDVKSSPIIWKLMTVPSY
1cf9A           ADQGEEGIVEADSADGSFMDELLTLMVWSRIPKI----DKIPA---------------------------
2a9vB           ASVVKAKHPEFGKTKVSVHSENIFEITVWENHNDEIIN--LPDDFTLAASS-ATCQVQGFYHKTRPIYAT
2a9vC           ASVVKAKHPEFGKTKVSVHSENIFEITVWENHNDEIIN--LPDDFTLAASS-ATCQVQGFYHKTRPIYAT
2a9vA           ASVVKAKHPEFGKTKVSVHSENIFEITVWENHNDEIIN--LPDDFTLAASS-ATCQVQGFYHKTRPIYAT
2an1C           P-DNALQQLSDVLEGRYISEKRFLLEAQVCQQDRQKRISTAINEVVLHPGKHMISTPTGSTAYSLSAGGP
2d7jA           GKVGRGEKAEYSLVEDEDEIFKGLPKRLKVWESHMDEVKELPPKFKILARS-ETCPIEAMKHEELPIYGV
3efeB           LDTRKHTSNNLEPNYKGEKFYELGPAVSDANLVTASGIAPLEFAMEVLKK-IDVFTLDALSWYNKTHKPE
2a9vD           ASVVKAKHPEFGKTKVSVHSENIFEITVWENHNDEIIN---LPDDFTLAASSATCQVQGFYHKTRPIYAT
3efeF           L-DTRKHTSNNLEYTKMVCPNYKGEKFYELNLVTASGIAPLEFAMEVLKKIDVFTLDALHSWYNLNKTHK
3d54D           KGALLQNSSGKFICKWVDLIVENRIPIAHGFGRYVKIDDVNVVLRYVKDVNGSDERIAGVLNESGNVFGL
2abwA           NIKLYSNFGNKFSFGGLDITICRNLTAACIRAPYIREILSDEVKVLATFSHESYGPNIIAAVEQNNCLGT
3dkyE           DVEEKTELFNVVVSLIRAYTLQNYDFIDENGETYGLTINLVNEVIA-GKTGFMKLLFDGAQRSK------
2abwB           NIKLYSNFGNKFSFGG-LDITICRNFYGSQNDSFICSREILSDEVKVTFSHESYGPNIIAAVEQNNCLGT
3efeD           LDTRKHTSNNLEYNYKGEKFYELGPAVSDANLVTASGIAPLEFAMEVLK-KIDVFTLDALSWYLNKTHKP
3efeC           YLDTRKHTSNNLEYTKMVCPNYKGEKFYELGPAVASGIAPLEFAMEVLKKIDVFTLDALHSWYNLNKTHK
2an1D           PDN-ALQQLSDVLEGRYISEKRFLLEAQVCQQDRQKRISTAINEVVLHPGKVAHMIEFEVYIDETFAFSQ
1aa7A           MGLIYNRMGAVTTE-----VAFGLVCATCEQ---------------------------------------
3cy6A           GFLAKDKMMNGGHYTYSENVEKDGLILTSRGPGTSFEFA-------LAIVEALNGKEVAAQVKAPLVL--
3efeA           LDTRKHTS-NNLEYTKMVCPNYKGEKFYELGPAVASGIAPLEFAMEVLK-KIDVFTLDALHSWYNKTHKP
1aa7B           MGLIYNRMGAVTTE-----VAFGLVCATCEQ---------------------------------------
3cz9A           GFLAKDKMMNGGHYTYSENVEKDGLILTSRGPGTSFEFALAIV-------EALNGKEVAAQVKAPLVL--
3b38A           GFLAKDKMMNGGHYTYSENVEKDGLILTSRGPGTSFEFA-------------------------------
3b3aA           GFLAKDKMMNGGHYTYSENVEKDGLILTSRGPGTSFKFA-------------------------------
3czaA           GFLAKDKMMNGGHYTYSENVEKDGLILTSRGPGTSFEFALAIV-------EALNGKEVAAQVKAPLVL--
3b36A           HPLAKDKMMNGGHYTYSENVEKDGLILTSRGPGTSFEFA-------LAIVEALNGKEVAAVKA-------
1c4fA           IL-VELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHERTIFFKD
2ab0A           IFPIGNMTGFPTLKDKIPAEQWLDKLLTSQGPGTAIDFG-------------------------------
2dufA           IL-VELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFK
2an1B           PDNALQQLSDVLEGRYIS-EKRFLLEAQVCQQDRQKRISTAINEVVLHPGKVAHMIEFEVYIDETFAFSQ
3bweE           GFGSKVTTHPLAGHYTYSENRVEKLILTSRGPGTSFE---------------------------------
3bweD           GFGSKVTTHPLAGHYTYSENRVEKLILTSRGPGTSFEFA-------------------------------
2c5sA           DNVKFKLKKFPNIKIDATHEAVSERLKDVFGIHKFNLAMKVPSELEDIKKG--ALAAFLQVKGDVKTFKI
2ahaA           -GVVPILVELDGDKFSVSGEGEGDATYGDLTLKFISTTGKLPVPWPTLVTTFRYPDHMKRHDFFKSAMPE
2abrB           RK--LAEYLIGGVAADDLPASEGANILKMYREYLGHSSFLLPPL-----PNTQFTRDTTCWIYGGVTLNP
1bfpA           -GVVPILVGDVNGKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFK


                         .         .         .         .         *         .         .:420
query           QGHPEASPGPHDAAPLFDHFIELIEQYRKTAK
1a9xB           QGNPEASPGPHDAAPLFDHFIELIEQYRKT--
1cs0B           QGHPEASPGPHDAAPLFDHFIELIEQYRKT--
1bxrB           QGHPEASPGPHDAAPLFDHFIELIEQYRKT--
1c30B           QGHPEASPGPHDAAPLFDHFIELIEQYRKT--
3bgyB           ELELELNTLESELLNVFMIIQD----------
1cf9A           --------------------------------
2a9vB           QFHPEVEHTQYG-RDIFRNFIGICASYRE---
2a9vC           QFHPEVEHTQYG-RDIFRNFIGICASYRE---
2a9vA           QFHPEVEHTQYG-RDIFRNFIGICASYRE---
2an1C           ILTPSLDAVPMFPHTLSARPLVINSSSTIRLR
2d7jA           QFHPEVAHTEKG-EEILRNFAKLCGE------
3efeB           YFFQLMNSIN----------------------
2a9vD           QFHPEVEHTQYG-RDIFRNFIGICASYRE---
3efeF           PEYFFQLM------------------------
3d54D           MPHPERAIGGEDGKKVFQSILNYLK-------
2abwA           VFHPELLPHTA----FQQYFYEKVKNYKYS--
3dkyE           --------------------------------
2abwB           VFHPELLPHTA----FQQYFYEKVKNYKYS--
3efeD           EYFFQLMNSIN---------------------
3efeC           PEYFFQLM------------------------
2an1D           RSDGLIISTPTGSTAYSLSAG-----------
1aa7A           --------------------------------
3cy6A           --------------------------------
3efeA           EYFFQLMNSIN---------------------
1aa7B           --------------------------------
3cz9A           --------------------------------
3b38A           --------------------------------
3b3aA           --------------------------------
3czaA           --------------------------------
3b36A           --------------------------------
1c4fA           DGNYKTRAEVKFEGDTLVNRIELKGIDFK---
2ab0A           --------------------------------
2dufA           SAMPEGYVQERTIFFKDDGN------------
2an1B           RSDGLIISTPTGSTAYSLSAGGPIL-------
3bweE           --------------------------------
3bweD           --------------------------------
2c5sA           TVHRSYKHFPMRTMELLPEIGGHILENTE---
2ahaA           GYVQERTIFFKDDGNYKTRAEVKFEGD-----
2abrB           MYWPARRQETLLTTAIYKFHPEFANAE-----
1bfpA           SAMPE---------------------------