[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for ecol0:AAC73177.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "2atjA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "2bwjC.bssp"
#ERROR : Can't open dsspfile "3bb4A.bssp"
#ERROR : Can't open dsspfile "3dsrB.bssp"
#ERROR : Can't open dsspfile "2dwqB.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "2bwjE.bssp"
#ERROR : Can't open dsspfile "2cxxA.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "1egaA.bssp"
#ERROR : Can't open dsspfile "2atxA.bssp"
#ERROR : Can't open dsspfile "1delB.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "3cwzA.bssp"
#ERROR : Can't open dsspfile "2e9sA.bssp"
#ERROR : Can't open dsspfile "3bfkB.bssp"
#ERROR : Can't open dsspfile "3a1vA.bssp"
#ERROR : Can't open dsspfile "2ak3A.bssp"
#ERROR : Can't open dsspfile "1an0A.bssp"
#ERROR : Can't open dsspfile "1byuB.bssp"
#ERROR : Can't open dsspfile "2cxxB.bssp"

## Summary of PDB Search
:232
    2e-40  11%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-38  31%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-37  11%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-36  11%  3cmvG  [x.x.x] PROTEIN RECA
    4e-36  11%  3cmvH  [x.x.x] PROTEIN RECA
    6e-36  10%  2bifA  [c.37.1 - c.60.1] PROTEIN
    1e-35  11%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    4e-35  13%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    6e-35  15%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    6e-35  11%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-34  11%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    5e-34  22%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-34  10%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    7e-34  10%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    2e-33  12%  3cmvC  [x.x.x] PROTEIN RECA
    2e-33  10%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-33  10%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    1e-32  28%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    2e-32   6%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-32  10%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    5e-32  13%  2b8tA  [x.x.x] THYMIDINE KINASE
    6e-32  13%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    9e-32  14%  3cmvA  [x.x.x] PROTEIN RECA
    2e-31  10%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    5e-31   7%  4dcgA  [x.x.x] VP39
    7e-31   9%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    8e-31  10%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    8e-31  10%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    9e-31  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    9e-31   9%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    1e-30  14%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    1e-30   9%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-30   9%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    6e-30  13%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    7e-30  11%  2cgtH  [x.x.x] 60 KDA GROEL
    7e-30  13%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    3e-29  15%  2cckA  [x.x.x] THYMIDYLATE KINASE
    6e-29  10%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    9e-29  14%  3cmxA  [x.x.x] PROTEIN RECA
    2e-28  12%  2akaB  [x.x.x] DYNAMIN-1
    2e-28  10%  1e98A  [c.37.1] THYMIDYLATE KINASE
    3e-28  22%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-28  10%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    4e-28  11%  3cmvE  [x.x.x] PROTEIN RECA
    4e-28  12%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-28  11%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    8e-28  10%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    8e-28  10%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    1e-27  15%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-27   9%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    1e-27  13%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    1e-27  10%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-27   7%  1aroP  [e.8.1] T7 RNA POLYMERASE
    3e-27  14%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-27  12%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    4e-27   8%  2ctsA  [x.x.x] CITRATE SYNTHASE
    3e-26  12%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-26   7%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    3e-26  11%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-25  32%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-25  12%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    2e-25  11%  3adkA  [x.x.x] ADENYLATE KINASE
    2e-25  11%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    2e-25  12%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-25  13%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-25  14%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-25   7%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    4e-25  10%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    4e-25  12%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-25  11%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-25  15%  1e2kA  [c.37.1] THYMIDINE KINASE
    8e-25  12%  3cmtD  [x.x.x] PROTEIN RECA
    8e-25  20%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-24  12%  421pA  [x.x.x] H-RAS P21 PROTEIN
    2e-24  11%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    2e-24  12%  2b8tB  [x.x.x] THYMIDINE KINASE
    2e-24  15%  2bdtA  [x.x.x] BH3686
    3e-24  11%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    3e-24   9%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    6e-24  11%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    8e-24  12%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    9e-24  10%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-23  10%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-23  10%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    2e-23  17%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    2e-23  10%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-23  10%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    3e-23   9%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    4e-23  10%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-23   6%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    6e-23   8%  2axzC  [x.x.x] PRGX
    1e-22   9%  1e0jA  [c.37.1] DNA HELICASE
    1e-22  10%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-22  12%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-22  10%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-22  11%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    3e-22  10%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-22  10%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-22  10%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    3e-22   9%  1e0jB  [c.37.1] DNA HELICASE
    4e-22   9%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-22  14%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    7e-22  20%  3cm0A  [x.x.x] ADENYLATE KINASE
    7e-22   9%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    8e-22  39%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-22  12%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    9e-22  12%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-21  11%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-21   7%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    1e-21  10%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-21   6%  2c0bL  [x.x.x] RIBONUCLEASE E
    2e-21  10%  3be4A  [x.x.x] ADENYLATE KINASE
    3e-21  11%  2cckB  [x.x.x] THYMIDYLATE KINASE
    3e-21  29%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    4e-21  16%  3c8uA  [x.x.x] FRUCTOKINASE
    5e-21  15%  3cmwC  [x.x.x] PROTEIN RECA
    6e-21  10%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    6e-21  17%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-21   9%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    9e-21  11%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    1e-20  11%  2b8tC  [x.x.x] THYMIDINE KINASE
    1e-20   8%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-20  12%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-20  13%  3da4A  [x.x.x] COLICIN-M
    2e-20  12%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    3e-20  14%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    4e-20  10%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    5e-20  11%  1e2hB  [c.37.1] THYMIDINE KINASE
    5e-20  11%  2c9oC  [x.x.x] RUVB-LIKE 1
    5e-20  12%  1e6cA  [c.37.1] SHIKIMATE KINASE
    7e-20  10%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    9e-20  10%  3dlbB  [x.x.x] ARGONAUTE
    1e-19  26%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-19  13%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-19  12%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-19  11%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-19   6%  2c4rL  [x.x.x] RIBONUCLEASE E
    2e-19  10%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-19  17%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-19   8%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    2e-19  12%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-19   9%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    3e-19   7%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    3e-19  13%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    3e-19  12%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-19   9%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-19  10%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-19  11%  3cmuA  [x.x.x] PROTEIN RECA
    5e-19   9%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    5e-19  13%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    6e-19   6%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    6e-19   9%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-19   9%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    6e-19   9%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    7e-19  10%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    7e-19  11%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    7e-19  13%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    7e-19   8%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    8e-19  15%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    9e-19  10%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    9e-19   9%  2bx2L  [x.x.x] RIBONUCLEASE E
    9e-19  10%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-18  13%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-18  37%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-18  15%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    3e-18  10%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    3e-18  34%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    3e-18  10%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-18  15%  2a1fF  [x.x.x] URIDYLATE KINASE
    4e-18  10%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-18  13%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-18  13%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    6e-18  10%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    7e-18  38%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    7e-18   9%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-18   9%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    9e-18  11%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-17   9%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    1e-17  10%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-17  14%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-17   9%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-17  13%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-17  10%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    2e-17  13%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-17  10%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17  10%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17  10%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-17  10%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17   9%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-17  14%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    3e-17   9%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-17   9%  3bczC  [x.x.x] PROTEIN MEMO1
    3e-17   9%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    3e-17  10%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-17  12%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    5e-17  11%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-17  10%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-17  15%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    6e-17  10%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-17   6%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    8e-17  10%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-16  12%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    1e-16  15%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-16   9%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-16  12%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-16  12%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-16  12%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    3e-16   9%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    3e-16  13%  3a00A  [x.x.x] GUANYLATE KINASE
    3e-16  10%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    3e-16   9%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    3e-16  10%  1e2iA  [c.37.1] THYMIDINE KINASE
    3e-16   8%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    4e-16  10%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-16   7%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    6e-16  12%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    7e-16  12%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    1e-15   7%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    1e-15  10%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15  13%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    1e-15  13%  3a00B  [x.x.x] GUANYLATE KINASE
    1e-15  10%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    1e-15   7%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    2e-15  12%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15   7%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    4e-15  11%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    4e-15  39%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-15  10%  1adoA  [c.1.10] ALDOLASE
    5e-15   9%  2bhvA  [x.x.x] COMB10
    5e-15  11%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    5e-15  16%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    6e-15  11%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    8e-15  10%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    8e-15   7%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-15   7%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    1e-14   8%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-14  14%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-14  13%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    2e-14   9%  1e2mB  [c.37.1] THYMIDINE KINASE
    2e-14  11%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    2e-14  10%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-14   9%  3ec1A  [x.x.x] YQEH GTPASE
    2e-14  13%  2dftA  [x.x.x] SHIKIMATE KINASE
    2e-14  12%  1e2mA  [c.37.1] THYMIDINE KINASE
    3e-14   7%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    3e-14  15%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-14  11%  2anbA  [x.x.x] GUANYLATE KINASE
    4e-14  10%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    4e-14  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-14  12%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    5e-14  11%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    6e-14  10%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-14  15%  2ancF  [x.x.x] GUANYLATE KINASE
    7e-14  13%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    7e-14  14%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-14   9%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    7e-14   9%  1eamA  [c.66.1] PROTEIN (VP39)
    8e-14  11%  2ancD  [x.x.x] GUANYLATE KINASE
    8e-14  15%  2dftC  [x.x.x] SHIKIMATE KINASE
    8e-14   8%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    1e-13   6%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    1e-13  13%  1e2iB  [c.37.1] THYMIDINE KINASE
    1e-13  16%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    1e-13   7%  3bm2B  [x.x.x] PROTEIN YDJA
    1e-13  11%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-13   8%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-13   9%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-13  31%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-13  10%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-13   7%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    3e-13  10%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-13  11%  2c95B  [x.x.x] ADENYLATE KINASE 1
    3e-13  21%  2d2eA  [x.x.x] SUFC PROTEIN
    4e-13  10%  1e2kB  [c.37.1] THYMIDINE KINASE
    5e-13  10%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-13  15%  2cdnA  [x.x.x] ADENYLATE KINASE
    6e-13  13%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-13  11%  1e2jA  [c.37.1] THYMIDINE KINASE
    7e-13  14%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    7e-13  10%  1e2nA  [c.37.1] THYMIDINE KINASE
    9e-13   8%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    1e-12  14%  2a1fD  [x.x.x] URIDYLATE KINASE
    1e-12  12%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    1e-12  15%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    1e-12   7%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    2e-12  12%  3cmvB  [x.x.x] PROTEIN RECA
    2e-12  12%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-12   9%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    3e-12   8%  2bhvD  [x.x.x] COMB10
    3e-12   9%  1e2nB  [c.37.1] THYMIDINE KINASE
    3e-12  10%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    3e-12  16%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    3e-12  11%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-12  11%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    5e-12  12%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    5e-12  31%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    5e-12  10%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    6e-12  15%  2a1fC  [x.x.x] URIDYLATE KINASE
    6e-12   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    6e-12  12%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    9e-12  11%  2ancB  [x.x.x] GUANYLATE KINASE
    1e-11  15%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-11  15%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    1e-11  14%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-11  15%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    2e-11  10%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    2e-11  12%  1e2jB  [c.37.1] THYMIDINE KINASE
    2e-11  11%  2c5mD  [x.x.x] CTP SYNTHASE
    3e-11  18%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    3e-11  14%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    3e-11  12%  3dfdA  [x.x.x] PROTEIN YQBN
    3e-11  14%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    3e-11  16%  3dkvA  [x.x.x] ADENYLATE KINASE
    4e-11   7%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    6e-11  15%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    8e-11  11%  1e2lA  [c.37.1] THYMIDINE KINASE
    1e-10  23%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10   8%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-10  14%  1e2lB  [c.37.1] THYMIDINE KINASE
    2e-10  12%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-10   7%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    3e-10  15%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-10  13%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    9e-10  13%  2b8tD  [x.x.x] THYMIDINE KINASE
    1e-09  14%  2a1fE  [x.x.x] URIDYLATE KINASE
    1e-09  16%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    1e-09  21%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    2e-09  21%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-09  12%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    2e-09  14%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-09  21%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-09  12%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    3e-09  10%  2an9A  [x.x.x] GUANYLATE KINASE
    7e-09  14%  1e2hA  [c.37.1] THYMIDINE KINASE
    8e-09  13%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    9e-09  12%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-08   6%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    1e-08  10%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-08  14%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    2e-08  13%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    5e-08   4%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    7e-08  12%  2bhvC  [x.x.x] COMB10
    1e-07  15%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    1e-07  10%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    1e-07  14%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    2e-07   7%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    3e-07  20%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    5e-07   8%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    6e-07  14%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    7e-07  20%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-07  14%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    8e-07   7%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    8e-07  11%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    1e-06  11%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    3e-06  13%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-06   4%  1chdA  [x.x.x] CHEB METHYLESTERASE
    5e-06   7%  2c9gA  [x.x.x] PENTON PROTEIN
    8e-06   7%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-05  21%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    2e-05  12%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    3e-05  17%  2atjA  [a.93.1] PEROXIDASE C1A
    4e-05   8%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    4e-05  10%  2c9oA  [x.x.x] RUVB-LIKE 1
    5e-05  18%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    8e-05  19%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    1e-04  21%  2bwjC  [x.x.x] ADENYLATE KINASE 5
    1e-04  18%  3bb4A  [x.x.x] T7I23.11 PROTEIN
    1e-04  15%  3dsrB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-04  22%  2dwqB  [x.x.x] GTP-BINDING PROTEIN
    2e-04  12%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-04  21%  2bwjE  [x.x.x] ADENYLATE KINASE 5
    3e-04  38%  2cxxA  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    3e-04   8%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    3e-04  15%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    3e-04  34%  2c9oB  [x.x.x] RUVB-LIKE 1
    3e-04  55%  1egaA  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    5e-04  30%  2atxA  [x.x.x] SMALL GTP BINDING PROTEIN TC10
    5e-04  23%  1delB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    6e-04  39%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    6e-04  25%  3cwzA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    6e-04  25%  2e9sA  [x.x.x] RAS-RELATED PROTEIN RAB-6B
    6e-04  38%  3bfkB  [x.x.x] SMALL GTPASE RAB11
    7e-04  24%  3a1vA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-04  32%  2ak3A  [c.37.1 - g.41.2] ADENYLATE KINASE ISOENZYME-3
    8e-04  25%  1an0A  [c.37.1] CDC42HS-GDP
    8e-04  31%  1byuB  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    8e-04  40%  2cxxB  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
:232

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGSLTIDGVDHTTMPPSR
3dmdC           -----------------EIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIE
3b5jA           -----------------INLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNR
3dmdB           -----------RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIE
3cmvG           EDRSMDVETISSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
3cmvH           ---------------ALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2bifA           ---------------------------IVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVK
2dwoA           -SRVQKIWVPVDHRPSLRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK
3c95A           -----------AGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKIL
2c03B           -----------------RLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAARE
2ccgB           ------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEI
2ccjB           -------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEI
2d3wB           MLSIKDLHVSVEDKAIGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSG
2ccgA           -------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEI
1bifA           ------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVK
3cmvC           EDRSMDVETISSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2dwpA           -----------------IWVPVDHRNSIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK
1e9cA           -----------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
3b60A           DLEFRNVTFTYPGREVPINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLAS
2czvA           -----------------IEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSFK
2a2zD           -----------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNV
2b8tA           ------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRQ
1e9fA           -----------------------RGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
3cmvA           -----------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2c61B           -----------------GTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITAQ
4dcgA           ------------------------ILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPIL
1e2dA           -----------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
2a30D           -----------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNP
1e9dA           ----------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
1e69A           ------------------SLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGSAY
1d1cA           ----------------RSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQILQANP
2cjwB           -----------------------TYYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATIILLDE
3eiuB           PYARLPPKDFIGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITAQ
3eiuA           -----------------GTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNE
3dm5A           -----------------PIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYH
2cgtH           ----------------------FENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMND
2a5gA           -----------------------KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVK
2cckA           -------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEI
2a2zA           -----------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNV
3cmxA           ----------------IALGALPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2akaB           MEDLIPLVNRLQDAFSAIGQNADDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNS
1e98A           ----------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
2bbsA           -EGFGELFEKAKGTPVDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSW
3a1wA           ---------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYK
3cmvE           -------TGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2bc9A           MCLIENTNGRLPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCV
2axpA           ---------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLL
2a30B           -----------------------RIKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQMMP
3czpB           ------------------KRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQP
2c03A           -----------ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAARE
1bg0A           -----------------QSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKHPPKQ--WG
2c9yA           ------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSLG
1e9rA           -----------------VPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1aroP           ----------------------------------------------------------------------
1e9sG           -----------------VPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3b85A           -----------------YVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGEKL
2ctsA           -----------------PKEQARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFI
1e9sJ           ------------------PMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2dr3A           ------------------HGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQ
2b8wA           MCLIENTNGRLPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCK
2awnC           -------------------------------ASVQLQNVTVSKDINLDIHE--GEFVVFVKSTLLRMIAG
2a2zB           -----------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNV
3adkA           ------------------EEKLKKSKIIFVVGGPGSGKGTQCEKIVGYTHLSTGDLLRAEVSSGSARGKM
2a5jA           ------------HSS-GLVPRGSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDGKQIK
1e9sF           -----------------VPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3b2qA           -----------------GTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIEEA
2c04A           -VILATVYEALALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAARE
2dr3E           -----------------LHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVNM
1e4yA           ---------------------------IILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
1e9sD           -----------------VPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1e9sB           -----------------VPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1e2kA           ----------------------PTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASETIA
3cmtD           ---------------ALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2awnD           -VQLQNVTKAWGEVVVDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
421pA           -----------------------TEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDG
2a30A           -----------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSEKP
2b8tB           ------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKILPSVEVE
2bdtA           -------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHDELLALTW
3d3kA           -------------LSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVACGPHVKGAQGISCGRHLA
1dekB           ---------------------------IFLSGVKRSGKDTTADFIMSNYSAVKY---------QLAGPIK
1cr4A           LSSEESVGLLFSGCTGDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
1e2fA           ----------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
3b2qB           -----------------GTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNA
3cddC           ---------------------------LKAGGKIYQGWTKIGITRSLETYKFQYKAFIEPIKQGQAVDIG
2akaA           -----------------SMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQINP
1cfrA           ----------------------------DIISKSGEGNKYTINSAIAFVAYASHSKVLSGLRDFINDEGG
3cr7C           ----------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
3d7wA           --YVSSGSFSNNIPLLRSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFLSD----
1e3mA           ----------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITERHPVVEQV
3dt2A           ----------EHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAGNL
1dekA           ---------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGV
2axzC           ----------------------------------------------------------------------
1e0jA           -HLSSSVGLLFSGCTGDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
1dhjA           ----------------------------------------------------------------------
3d3qA           -----------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQTAKVTTEE
3dt4A           ALRIASRLAKEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAGNL
3clvA           -------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTNLCNIK
3cddF           DWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIE
1dhiA           ----------------------------------------------------------------------
3czpA           -------EQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQP
1e0jB           LSSEESVGLLFSGCTGDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
2d0kA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEGR
3cm0A           ------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTPG
1e3aB           ------QEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMNP
2awnB           -VQLQNVTKAWGEVVVDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2bjbA           ------------------IEPGPGAR--VDCGLAG----TVLRFVPPLAALGSVPVTFDGDQARGRPIAL
3cddD           ----------------EIVLKAGGKIYQGWLEASGAFDLETY----KFNDAQYKAFIEPIKQGQACTVDG
3cr7A           -----------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGFS
2bhjA           -------------------------------------------------NWGSGEILHDTLHHKATSCNP
1e9sM           ------------------PMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2c0bL           -------------------------------------------------------------EAIKKAAES
3be4A           ---------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLATGDMLREAIKNGIGLEAK
2cckB           ---------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEI
2d62A           -VKLINIWKRFGDVTADLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEKVPP
3c8uA           -----------------LDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPDGFHLDN---
3cmwC           -----------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2dr3B           ------------------HGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQ
3bb1A           ----------------NLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
1e59A           ---------------VTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYT
1e2gA           -----------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGK
2b8tC           ------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSRTGTS
1ai4B           ------------------TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGYIANWNNSPQKDYPAS
3d3qB           -----------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKV
3da4A           -VLHPGISVYDAYHFA-KPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLKISPK
1dkiA           -----------YNLLTPVIEKVKPGEFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSNNPYFN
4atjA           -------------------------------------RDTIVNELRSDPRIAASILRLHFEDCFVNGCDA
2bkiA           TIKSYQGKSLGTMPPHVFAKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL
1e2hB           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGAR
2c9oC           -----------------IKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKK
1e6cA           -------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVAE
2ahwD           ------------------VNYIPDEATLCVLGAILEATTLITALADKYKSPTGLGDRADRGISPLAQEGK
3dlbB           -------------------VWVEGLAVYRREHARGPGWRV----------------LGGAVLDLWVSDSG
3bk7A           ----------GSFKLEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYKPQYIK
2d4uA           -----------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWVALNR
3dm9B           -----------------EEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIR
2b92B           MCLIENTNGRLMANPEILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCV
2c4rL           ----------PRAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAAE
2drcA           ----------------------------------------------------------------------
1d6jB           ----------ASALTRRTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHALDGDNIRFGLNKD
2boeX           ----------------------------------------------------------------------
3crmA           -----------------------LPPAIFLMGPTAAGKTDLAMALADALPCELISVDSALRGMDIGTAKP
2bkhA           ----------------RDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLL
3czjA           --------------------------------------------------------------LSVTLPAA
2c7cH           ----------------------------------------------------------------------
2d4hB           MCLIENTNGRLMANPEALSAITQPMVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLDTEGLGQAV
3dtbB           -----------HMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGN
1e9rF           ----------------GVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3cmuA           -----------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
2bofX           -----------------------------------------------YVNPNMSSAEWVRNN-----PND
1cjtC           ------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIEM
3ch4B           ------------------PLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYEHG
3cr7D           ----------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
3dauA           ----------------------------------------------------------------------
2ahvA           ------------------VNYIPDEATLCVLGAGGGATTLITALADKYKSPTGLGDRADRGISPLAQEGK
3dt4C           -----------HMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGN
1dg3A           MCLIENTNGRLPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPGHILL
1cr1A           LSSEESVGLLFSGCTGDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
1bglA           ----------------------------------------------------------------------
2d4uB           --------------------------------------------------------------------NR
2cvfA           ------LSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQM
2bx2L           -------------------------------------------------------------WEAIKKAAE
1e9sH           ------------------PMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1cs4C           ------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIEM
2awoC           -----------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
1accA           ---LPQIQETTARIIFNGKDLNLVERRIAAVNPSTTKPDMALKIAFGFNEPN-GNLQYQGKDI-------
2c61A           ------------------TNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGITNA
3dhwC           MIKLSNITKVFHQGTRTISLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESE
1draA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e9rE           -GKLKRMTREKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1cr2A           ----------------DKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
2bwjA           -----------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESER
3d31A           MIEIESLSRKWKNFSLDLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSPEK
1dyhA           ----------------------------------------------------------------------
3bo6B           -----------------LDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDKFHIS
2b8wB           MCLIENTNGRLPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCV
1aldA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3bb1B           ----------------NLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVSRSRA
4dfrA           ----------------------------------------------------------------------
3cr7B           -----------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
3cioD           ------------TSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSNE
2d4hA           MCLIENTNGRLPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMWCVPHP
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3bgwA           -----------------MTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIK
3dftD           ----------------------------------------------------------------------
3dt7A           ALRIASRLAKEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGN
1ek0A           -----------------------TSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTIN
3dfnA           ----------------------------------------------------------------------
3bczC           ----------------REASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCHAY
3bgwD           -----------------MTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIK
1drbA           ----------------------------------------------------------------------
1dvrA           -----------------------ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAGTQLG
1e9sL           -----------------VPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3dftC           ----------------------------------------------------------------------
1culC           ------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIEV
3dfqD           ----------------------------------------------------------------------
1afrA           ------------------THSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPAVRDETGAS
3dfpC           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------RYTLRARGHPNV--TAGH
1eilA           ----------------------------------------------------------------------
2czvB           ------------------ELAKEWFDEVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTVQK
1ak2A           -----------------------KGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSKA
1e9rD           -GKLKRMTREKAKQVTGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
3dffA           -------------------------------------------LLAISPHLDDAVLSFGGLAQAAQDGAN
2eg5G           -----------------NLPNINKCIKVADLGCASGPNTLLTQSIDKVGQLERPTIQIFLNDLFPNDFNF
3a00A           ---------------------------IVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVN
6aldA           ----------------------------------------------------------------------
3bh0A           -SADGNITGVPSGFTERMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIK
1e2iA           ---------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHR
2ck3C           IIPRISVREPMQTGIKDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIK
3dfnD           ----------------------------------------------------------------------
2dr3F           -----------------LHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEPVQVRQNM
1akeA           ---------------------------IILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKGSELG
2ausC           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3bjdB           --------------------------------------------LPQLQNLPIEEARIVADALAVHATSR
3a00B           -------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVN
3c15C           ---------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIE
3dymA           ----------------------------------------------------------------------
1e9rG           ------------------PMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2dr3C           ------------------HGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQ
1av6A           ------------------------ILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPIL
2awoA           -VQLQNVTKAWGEVVVDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
1adoA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3c14C           ------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIE
3ecpA           ---------------------------------------------SALHRAADWAKSVFSSAALGDPRRT
3bpbA           ------------------DYAKALEQHNAYIRALQVDITLLPPDERSVFVEDPVLCTSRCAIITRPGAEG
1c9kC           ---------------------------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHH--KDGRP
1e9sE           ------------------PMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1dw9A           ------------------LSKAKKDLFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSI
5dfrA           ----------------------------------------------------------------------
1d6jA           ----------ASALTRRTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
2ccjA           -------------------------AFITFEGPEGSGKTTVINEVYHRLVK------DYDVIMTREPGGV
1e2mB           -----------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGAS
3b55A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3ec1A           --------------------------------------------------GKGNVITTSYFPGTTLDMIE
2dftA           ---------------------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIAG
1e2mA           -----------------------TLLRVYIDGPHGMGKTTTTQLLRDD-IVYVPEPMTYWRVLGASETIA
2dflA           -----------------LAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEGT
3bb1E           ----------------NLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
2anbA           -----------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEV
3bwdD           -----------------------RFIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDYNR
2bbsB           -----------------INFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS-------
1cr0A           LSSEESVGLLFSGCTGDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA
1cjuC           ------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIE
1e4vA           ---------------------------IILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
2ancF           -----------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFL
3cnlA           -----------PRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILDTPYK
1e9sI           ------------------PMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2dr3D           -----------------LHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHQVRQNM
1eamA           -------------------LQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDP--
2ancD           -----------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEV
2dftC           ---------------------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIAD
2aumA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1e2iB           -----------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY------W
3ed8A           -----------GNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQNTPIGD
3bm2B           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3bb1H           ----------------NLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
1bmfC           -----------------SLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIG
2awnA           -VQLQNVTKAWGEVVVDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
2aunA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3e8aC           ------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIE
2c95B           -------------------EKLKKTNIIFVVGGPGSGKGTQCEKIYGYTHLSTGDLLRSEVSSGSARGKK
2d2eA           QLEIRDLWASIDGETIGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSP
1e2kB           -----------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGAS
3bv4A           ----------------------------------------------------------------------
2cdnA           -----------------------SHMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTELFRRNIEEGTKLG
3bb1F           -SGINTFAPATQTKLLELKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
1e2jA           -----------------------TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYETIANIYTTQHR
3b85B           ------------------VDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIIL---TRPAVEAG
1e2nA           -----------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGAS
3di4A           -----------------RCFEVKAGQFFRISSVEGPQVGDLNLHN-----LHDLTERFFSGKTRALHGTH
2a1fD           ----------------------------------------------------------------------
3c7kC           ---------------------------LLLLGAGESGKSTIVKQMKIIHED-----------GFSGEDVK
3d1mA           ----------------------------------------------------------------------
1cjaA           --------SFRVITTLANQANILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDVIVNNSDRLP
3cmvB           ----------LSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYA
1e9rB           -----------------------EPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2bv7A           ------------------VFTPIKADISGNYDTNPTKFRTLQNILEVEKEMYGAEWPKVGATLALMWLKR
2bhvD           ----------------------------------------------------------------------
1e2nB           -----------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPLGASETIANI
2a5vA           -----------------YAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDV------VERVA
3dvlD           ---------------------LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEQDIIKNA
1e9sA           -----------------VPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2a5vB           -----------------YAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERV------A
3cueF           ---------------------YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELKLQIWD
1b0uA           KLHVIDLHKRYGGHEVGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRLLR
1azsC           ---------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEAIE
2a1fC           ----------------------------------------------------------------------
3brwA           -LECNPTARIYREHFNYYSLDTALGHLVFSLKYDVIGDQ-----------------EHLRLLLRTKCRTY
1bccF           ------------------------------------------------------------------GIRK
2ancB           -----------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEV
3cnnA           -----------------KKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDTPGIL
3d1mB           ----------------------------------------------------------------------
2dpyB           -----------------ALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFG
3cphA           --------------------------KILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDIN
1ckvA           -----------------ENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTIKANGKIEVDCDS
1e2jB           -----------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGAS
2c5mD           ----------------------------------------------------------------------
3c7kA           ---------------------------LLLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTIQSLA
3bjqB           ----------------------------------------------------------------------
3dfdA           -----------------FIFKAITTDRIDELEKENTTKEL-------DSQRFYARIAVETTVYPTFKAKR
2dpyA           -----------------ALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDLG
3dkvA           ---------------------------IVLMGLPGAGKGTQAERIVEKYG--IPHISTGDMFRAAMTPLG
1e1qB           -----------------SLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAQK
2e85B           ----------------------------------------------------------------------
1e2lA           ---------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGAS-ETIANI
2bbtB           -ELFEKAKQNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSW
2bkeA           VKKERNVKKISSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEGT
1e2lB           -----------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGAS
2e85A           ----------------------------------------------------------------------
3bs4A           ---------------------KKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPLQLIIL
3bb1C           ------------------KQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
1d8jA           ----------------------------------------------------------------------
2b8tD           ------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKSIRNIQSR
2a1fE           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bwjB           -----------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST--------------
2d3wD           MLSIKDLHVSVEDKAIGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVEFKGKDLLALSPEDRAG
3cr8B           ----------------------------------------------------------------------
1e9sK           -----------------------EPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
2d3wC           MLSIKDLHVSVEDKAIGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGLSPEDRAG
2d7vA           VAALSSCHLVFLSIAARYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKHHLAH
2an9A           -----------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEV
1e2hA           -----------------------TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGAS-ETIA
3bb1G           ----------------NLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
3dm5B           -----------------PIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYH
1d6aA           -----------------VMSFTEKTEAEFLLVAIQMVSEAARFKYIENQV-KTNFNRAFNPNPKVLTWGK
1cjvC           ------------------------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEAIETI
3cbqA           --------------------------KVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVD
2d7vB           -----------------YLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKHHLAH
3cd9A           -------------------YNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQNTPIGDGP-V
2bhvC           ----------------------------------------------------------------KMIPAF
1ckeA           ------------------------APVITIDGPSGAGKGTLCKAMAEALLLDSGAIYVDVASEDALVPLA
2a78A           ---------------------------VIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDG
3do6A           ----------------SLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLR----------
2b0lC           ----------------------------------------------------------------------
2bwjD           ---------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST--------------
1d2zD           FPAEIKKGFKYTAQDVEAANRLPPDQSKSKTSGKLNERPTVGVLLQLLVLFSAADFVALDFLNESTPARG
3b9qA           IKDALKESVLEMLAKSELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFRAAASD
2awoD           -VQLQNVTKAWGEVVVDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE
3cddA           ----------------------------LETYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDD
3cqcA           LKQGNAIMRKFLASKKHVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKP
3c85A           -----------------------------------------------LINPGHAQVLILGGRIGTGAYDY
1delA           ---------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDAYAWGVFA
3bb1D           ----------------NLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSR
1chdA           ----------------------------------------------------------------------
2c9gA           VMVSRSLTKDKQVELKWVEFTLPEGNYSETMTIDLMNNAIVEHYLK------------------------
3cddE           ---------------------KIYQGWTKIGITRSLEASGAFDLETYKFLGNYKAFIEPIQGQACTVDIG
2bwjF           ---------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLS---------------
1agpA           ---------------------------LVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDG
2atjA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
2c9oA           --AASGLVGQENAREALIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKK
2ax4B           ----------------------FRGCTVWLTGLSGAGKTTISFALEEYLSHAIPCYSLDGDNVRHGLNRN
2ax4A           ----------------------FRGCTVWLTGLSGAGKTTISFALEEYLVSHIPCYSLDGDNVRHGLNRN
2bwjC           ---------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLS---------------
3bb4A           -------------------------EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTV------------
3dsrB           -------------------NTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSAFAVVFAAMGITNEEA
2dwqB           --------------------------AVGIVGLPNVGKSTLFNALTRANALAKNVGVVPLEDERLYALQR
3cddB           -------------------QGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIKQGQACTVDI--
2bwjE           ---------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKY---------------------
2cxxA           --------------------------TIIFAGRSNVGKSTLIYRLTG-----------------------
3ci2A           ----------------------------------------------------------------------
1dapA           ------------------HTGMPHGGHVITTGDTGGFNHTVEYKLDRNPDFTASSQIAFGRAAHRMKQQG
2c9oB           -----------------IKSKKMAGRAVLLAGPPGTGKTALALAIAQEL---------------------
1egaA           ---------------------------IAIVGRPNVGKSTLLNKLLG-----------------------
2atxA           ---------------------------CVVVGDGAVGKTCLLMSYAN-----------------------
1delB           ---------------------------IFLSGVKRSGKDTTADFIMSNY---------------------
2a5fA           ---------------------------ILMLGLDAAGKTTILYKL-------------------------
3cwzA           ---------------------------LVFLGEQSVGKTSLITRFMY-----------------------
2e9sA           ---------------------------LVFLGEQSVGKTSLITRFMY-----------------------
3bfkB           ---------------------------IVLIGDSGVGKSNLLSRFTRD----------------------
3a1vA           ---------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGV-TVEKKEG----
2ak3A           ---------------------SARLLRAAIMGAPGSGKGTVSSRITKHF---------------------
1an0A           ---------------------------CVVVGDGAVGKTCLLISYTT-----------------------
1byuB           ---------------------------LVLVGDGGTGKTTFVK---------------------------
2cxxB           ---------------------------IIFAGRSNVGKSTLIYRLTG-----------------------


                         .         .         *         .         .         .         .:140
query           RPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQGKMHAIARQMGIDNLMARLPGELSGGQRQRVAL
3dmdC           QLEEHAKRIGVKVIKHSYGAD---------------PAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNL
3b5jA           RQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISGYNTIVGEQGAGLSGGQRQRIAI
3dmdB           QLEEHAKRIGVKVIKHSYGADPA---------------AVAYDAIQHAKARGIDVVLIDTAGRSETNRNL
3cmvG           RKLGVDIDNLLCSQPDTGEQALEICDALARSG-AVDVIVVDSVAALTPKAEIEGLAARMMSQAMRKLAGN
3cmvH           RKLGVDIDNLLCSQPDTGEQALEICDALA-RSGAVDVIVVDSVAALTPKAEIEGLAARMMSQAMRKLAGN
2bifA           TYKSFEFFLPDNEEGLKIRKQC--------------ALAALNDVRKFLSEEGGHVAVFDATNTTRERRAM
2dwoA           QYSSYNFFRPDNEEAMKVRKQ--------------CALAALRDVKSYLAKEGGQIAVFDATNTTRERRHM
3c95A           RVDAQLYNGFFSDADRAAMKIVLET--EPRNLPALDITFVDKRIEKLLFNYRARNFPGTLDYAEQQRWLE
2c03B           QLRLLGEKVGVPVLEVMDGES---------------PESIRRRVEEKARLEARDLILVDTAGRLQIDEPL
2ccgB           RKIVLEGN------DMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEE
2ccjB           RKIVLEGNDMDIRTEAMLFAASRREHLVLKVI------PALKEGKVVLCDRYIDSSLAYQGYARGIGVEE
2d3wB           EGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMPEDLLTRSVNVGFSGGEKKRNDI
2ccgA           RKIVLEGNDMDIRTEAMLFAASRR------EHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEE
1bifA           TYKSFEFFLPDNEEGLKIRKQC--------------ALAALNDVRKFLSEEGGHVAVFDATNTTRERRAM
3cmvC           RKLGVDIDNLLCSQPDTGEQALEICDAL-ARSGAVDVIVVDSVAALTPKAEIEGLAARMMSQAMRKLAGN
2dwpA           QYSSYNFFRPDNEEAMKVRKQCALAAL--------------RDVKSYLAKEGGQIAVFDATNTTRERRHM
1e9cA           LLSSY-LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQP
3b60A           LRNQVALFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAI
2czvA           SYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAMVKKNVALGFSLRPLLYSNPYERANLAW
2a2zD           ERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQ
2b8tA           SRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFNGFVVIISGLDKNFKGEPFGPIAKLFTY
1e9fA           L-LSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQP
3cmvA           RKLGVDIDNLLCSQPDTGEQ---------------ALEICDALARSGAVDVIVVD-------------SV
2c61B           YFMSDFEKTGALERAVVFLNLADDPAMHVLVILTDITNYAEAPGYMYTDLATLYERAGIVKGAKGSVTQI
4dcgA           RDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSLKWRCPFPAQWIKDFYIPHGNKMLQPF
1e2dA           LLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD
2a30D           ERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQ
1e9dA           LLSSY-LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQP
1e69A           VELDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGEKALVGL
1d1cA           ILEAFGNAKTTRNNNSSRFGKFIEIQFNNSGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKK
2cjwB           NHDHMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRREVSVSEGRAAVVFD
3eiuB           YFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHTDLATLYERAGIVKGAKGSVTQI
3eiuA           EAMSDFEKTGALERAVVFLNLAHVLVILTDITNYAEALRQMGPGYMYTDLATLYERAGIVKGAKGSVTQI
3dm5A           QLRQLLDRYHIEVFGNPQEKDAI---------------KLAKEGVDYFKSKGVDIIIVDTAGRHKEDKAL
2cgtH           SKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPET
2a5gA           FNVWDVGGLDKIRPLWRIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQE
2cckA           RKIVLEDMDIRTEAMLFAAS------------RREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGI
2a2zA           LQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRY-IFASNLYESECMNETEWTI
3cmxA           RKLGVDIDNLLCSQPDTGEQALEICDAL-ARSGAVDSQAMRKLAGNLKQSNTLLIFINQIRNPETTTGGN
2akaB           TTEFLHCKGKKFTDFEEVRLEIEAETNKGISPVPINLRVYSPHVLNLLPGMTKVPVGDQPPDIEFQIRDM
1e98A           L-LSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQP
2bbsA           IMPGTIKENIIGVSYDEYRYRS-------------VIKACQLEEDISKFAEKDNIVLITLSGGQRARISL
3a1wA           GYDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKK
3cmvE           RKLGVDIDNLLCSQPDTGEQALEICDALA-RSGAVDVIVVDSVAALTPKAEIEGLAARMMSQAMRKLAGN
2bc9A           PHPKKPGHILVLL------------DTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQ
2axpA           ADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHALRVRGDEYIEGKDIDSILE
2a30B           ERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFEVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQ
3czpB           IPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQERF-K
2c03A           QLRLLGEKVGVPVLEVMDGES---------------PESIRRRVEEKARLEARDLILVDTAGRLQIDEPL
1bg0A           DINTLVGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVDELKGTYYPLTGMSKATQQQLID
2c9yA           KKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQALMEKRKEKLDSVIEFSIPDSLLI
1e9rA           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
1aroP           ----------------NDFSDIELAAIPFNTLADHYG--ERLAREQLALEHESYMGEARFRKMFERQLLI
1e9sG           RDKDIILNPYDQRTKGWSFFNEIRND--------------------YDWQRALSVVPRGKTDEAEEWASY
3b85A           GFLPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLRGRTLNDAFVILDEAQNTTPAQKFLTRLGFGSKVVT
2ctsA           PECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAHVVTMLDNFPTNLHPMSQLSAAI
1e9sJ           RDKDIILNPYDQRTKGWSFF-------------------NEIRNDYDWQRYALSVVPRGKTDEAEEWASY
2dr3A           NMAQFGWDVKPYEEK-------------------GMFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLR
2b8wA           PGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINLTHRIRSKSVSFFPDFVWTLRDF
2awnC           LGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
2a2zB           LQWSFTFQTYACLSRIRAQLASLNGEKPVLFFRSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQ
3adkA           LSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMT
2a5jA           LQGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKR
1e9sF           RDKDIILNPYDQRTKGWSFFNE-------------------IRNDYDWQRYALSVVPRGKTDEAEEWASY
3b2qA           QYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMLTAAEYLAYEHGMHVLVILTDITNYAEALRQMGA
2c04A           QLRLLGEKVGVPVLEVMDGESPE---------------SIRRRVEEKARLEARDLILVDTAGRLQIDEPL
2dr3E           AQFGWDVKPYEEKGMFA---------------------MVDAFTAGIGKEYEKYIVHDLTDIREFIEVLR
1e4yA           GKQAKDIMDAGKLVTDELVIA-------------------LVKERIAQEDCRNGFLLDGFPRTIPQADAM
1e9sD           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT-------------------DEAEEWASY
1e9sB           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
1e2kA           NIYTTQHRLDQGEISAGDAAVVMTSA---------------QITMGMPYAVTDAVLAPHIGGEAGPPPAL
3cmtD           RKLGVDIDNLLCSQPDTGEQAICDALARSGAVDVIVVDSVAALTPKAEMGLAARMMINQIRMKNPETTTG
2awnD           RGVGMVVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGK
421pA           ETGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVES
2a30A           ERWSFTFQTYACLSRIRAQLASLNKLKDAEKPVLFFERSVYSDSNLYESECMNETEWTIYQDWHDWMNNQ
2b8tB           SAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTY
2bdtA           KNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKKGERCL
3d3kA           QVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVD---LVINCLDCPENVFLRDQPWYKAAV
1dekB           DALAYAWGVFAANTDYPLTRKEFEG--------IDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVF
1cr4A           EDLIGLHNRVRLRQSDSLKREI----------IENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLA
1e2fA           LLSSY-LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQP
3b2qB           QYFMSDFEKTGALERAVVFLNLADDTDITNYAEALRQMGRGYPGYMYTDLATLYERAGIVKGAKGSVTQI
3cddC           GERVITGYVDDWVPSYDESTITSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTQRIQIEQGETPHELL
2akaA           ILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGSIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKA
1cfrA           KISDGSFNKCNWYEWLIGIRAIEFFLESETNATSFDVMSIYKSCLSEFIYDLRSKLVNLITSNPDFSIID
3cr7C           KADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPDPKGLYKKAREGVIKEFTGI
3d7wA           ----APAGAETQDFSGTTSSSQPFNGSYPDLERYAG-----HRDQIPLGIDQLIQSVTALRFPGGQTKTQ
1e3mA           LNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGFVETETA
3dt2A           RAINPENGFFGVAPGTSVKTNPNAIKTIQKFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDE
1dekA           FAAGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQW
2axzC           -----------------------------------DKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPYPI
1e0jA           EDLIGLHNRVRLRQSDSLKREIIENGKF---DQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLG
1dhjA           ---------------------ISLIAALAVDRVIGMENAMPWNLPASLAWFKRNTLDKPVIMGRHTWESI
3d3qA           EGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKKYLASF
3dt4A           RAINPENGFFGVAPGTSVKTNPNAIKKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDE
3clvA           FDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNLDRAKTWVNQLKISSNYIIILVANKIDKNFQVDI
3cddF           LLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIKAAGIKADVTD
1dhiA           -----------ISLIAALAVDRVIGME----------NAMPWNLPASLAWFKRNTLDKPVIMGRHTWESI
3czpA           YLWRFWRHIPARRQTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYWLAIDKQTQERF-K
1e0jB           EDLIGLHNRVRLRQSDSLKREIIENGK---FDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLG
2d0kA           -----------ISLIAALAVDRVIGNE----------NALPWNLPADLAWFKRNTLNKPVIYGRHTWESI
1e3mB           HPVVEQVLNEPFIANLSPQRRLIITGPNGGKSTYRQTALIGSYVPAQKVEIGPIDRIFTRVGTFVETETA
3cm0A           ERVRPIMERGDLVPDDLILELIREELAERVIFD----GFPRTLAQAEALDRLLSETGTRLLGVVLVEVEL
1e3aB           KVYNPQSGYIANWNNVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLRLFLPTLQAATSGLTQSDPRRQLV
2awnB           RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
2bjbA           RELGVAVDGTGLPFRVRGNGSLAG-----------GTVAIDASASSQFVSGLLLSAAS--FTDGLTVQHT
3cddD           GERVITGYVDDWVPSYDESTITILVDCSIDYPSGQFNNQADIVCKPFGIKVIVNFQRIQIEQGETPHELL
3cr7A           EADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFPKGLYKKAREGVIKEFTGI
2bhjA           KSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVETTGTYQLTLDELIFATKMAWRN
1e9sM           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
2c0bL           RPAPFLIHQESNVIVRAFRDYLRQDIGEDNPKVLELARQHIAALGRPDFSSKIKLYTGEIPLFSHYQIES
3be4A           SIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVISGRCTHPAS
2cckB           RKIVLDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYGIGVEEVRALNEFAINGLYPDL
2d62A           KERDVAVFQSYALYPHTVYDNIAFP-LKLRKVPKQEIDKRVREVAELGLTELLNRKPRELSGGQRQRVAL
3c8uA           ----RLLEPRGLLPRKGAPETFDFEGFQ--------RLCHALKHQERVIYPLFDRARDIAIAGAAEVGPE
3cmwC           RKLGVDIDNLLCSQPDTGEQALEICDAL-ARSGAVDVIVVDSVA------ALTPKAEIEGEIGDSHMGLA
2dr3B           NMAQFGWDVKPYEEK----------------------GMFAMVDAFTAGIGEKYIVHDLTDIREFIEVLR
3bb1A           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRRVDNLDKLVAKAITDSFGWNKAIVAL
1e59A           SNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHD
1e2gA           LLSSY-LQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQP
2b8tC           VEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGPIAKLFTY
1ai4B           DLFAFLWGGADRVTE-IDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLV
3d3qB           TTIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYDKKQVKLKLKELEL
3da4A           SGVVGTFPVSTKFTHATGDYNVITGAYLGNITLKTEGTLTISANGSGIIGESLTRLGAMFSGKEYQILLP
1dkiA           HP-KNLFAAISTRQYNWNNILPTYSG--RESNVQKMAISELMADVGISVDMDYGPSSGSAGSSRVQRALK
4atjA           --SILLDNTTSFRTEKDAFGNANSA--RGFPVIDRMKAAVESACPRTDLLTIAAQQSVTLAGGPSWRVPL
2bkiA           EAFGN--AKTVRNNNSSRFGKFVEIHFNEKSSVVHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRER
1e2hB           LDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEPPPALTLIFDRHPIAALLCYPAARYLMGSM
2c9oC           TEMENFRRAIGLRIKETKKKEIIQDVTLDVAGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYL
1e6cA           GWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHAEELALRLQASLQAHQRPTLTGRPIAEE
2ahwD           WALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDL
3dlbB           AFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELDYHASKGRLQGREGGR
3bk7A           AEYEGTVYEL---------------LSKIDSSKLNSNFYKTELLKPLGIIDLYDRNVEDLSGGELQRVAI
2d4uA           AGIRYMMDQNNIGSGSTVAELMESALKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNALAELIQL
3dm9B           IGVKVIKHSYGADPAAVAYDAIQHAK-------------------------ARGIDVVLIDTAGRSETNR
2b92B           PTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTIQAMDQLYYVTELTHRIRSKSSFVSFFPDFVWT
2c4rL           RPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKITGEIPLFSHYQIES
2drcA           -----------ISLIAALAVDRVIGM----------ENAMPFNLPADLAWFKRNTLDKPVIMGRHTWESI
1d6jB           LGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARVATPGEETGLPFVEVYVDVPVEVAE
2boeX           --------DSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHN---PGQITGQVDALMSA
3crmA           SRELLARYPHRLIDIRDPAESYSAAEFRADALAAMAKA---TARGRIPLLVGGTMLYYKALLEGLPYTVA
2bkhA           EA--FGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRKEERNYHIFYRLCAGASEDIRER
3czjA           SHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRADNDIGVSEATRIDPNA
2c7cH           ----AQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPET
2d4hB           LLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSPDFVWTLRDFSLDLEADGQPLTPRLC
3dtbB           RAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGPLAPGVTITSWKNKEWRPQDE
1e9rF           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
3cmuA           RKLGVDIDNLLCSQPDTGEQALEICDAL-ARSGAVDVIVVDSVA---ALTPKAEIEGEIGDSHMGLAARM
2bofX           PRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAGKIPILVVSNAPGRDCGAPSHSAYRSWIDE
1cjtC           SNLVPPVELANPENQFRVDYIL------------------------------------------------
3ch4B           LNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIISQPIWLVSDTRRVSDIQWFREAYGAVTPGVDDAESEC
3cr7D           KDLGFSEADRNENIRRIAEVAKLFADITSFISPYRKDRDTARQLHEVEQRDPKGLYKKAREGVIKEFTGI
3dauA           -----------ISLIAALAVDRVIGMENAM---------PWNLPADLAWFKRN-TLNKPVIMGRHTWESI
2ahvA           WALCGHWGQSPRISDLAEQNKIIAYNYPQGVLQTLRAAAAHQPGIISGIGTFVDPRQQGGKLNEVTKEDL
3dt4C           LRAINPEGFFGVAPGTSVKTNPNAIKKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDE
1dg3A           DTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQYVTELTHRIRSSADFVSFFPDFVWT
1cr1A           EDLIG------------LHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAK
1bglA           ---------------------------------------KKQLLTPLRDQFTRAPLDNDVSEATRIDPNA
2d4uB           AGIRYMMDQNNIGSGSTVAELMESASIS-LKQAEKNWADYEALPRSTAAAAEIKRNYDIYHNALAELIQL
2cvfA           AETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEVLLWIARKHNIPVI
2bx2L           SRPAPFLIHQESNVIVRAFRDY-LRQDIGEILIDNPKVLELARQGRPDFSSKIKLYTGEIPLFSHYQIES
1e9sH           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
1cs4C           SNLVPPVELANPENQFRVDYIL------------------------------------------------
2awoC           RGVGMVALYPHLSVAENMSFGLKLAGAKKEV----INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
1accA           ------TEFDFNF-DQQTSQNIKNQLA------ELNATNIYTVLDKIKLNAKMNIDKRFHYDRNNIAVGA
2c61A           QYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMG
3dhwC           LTKGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAI
1draA           -----------ISLIAALAVDRVIGM----------ENAMPWNLPAELAWFKRNTLDKPVIMGRHTWESI
2a1fF           ------------------------------------------------------------SQPIYKRILL
3dfnC           ------------------------------------------------------SHPALTPEQKKELSDI
1e9rE           RDKDIILNPYDQRTK-------------------GWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASY
1cr2A           EDLIGLHNRVRLRQSDSLKREI-----------IENGKFDQWFDELFGNDTFHLYDSFEAETDRLLAKLA
2bwjA           KLIRDIMERGDLVPSGIVLELLAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMT
3d31A           HDIAFVYQNYSLFPHMNVKKNLEFGMRMK---KIKDPKRVLDTARDLKIEHLLDRNPLTLSGGEQQRVAL
1dyhA           -----------ISLIAALAVDRVIGMENAM---------PWNLPADLAWFKRN-TLDKPVIMGRHTWESI
3bo6B           VQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSGAQFTLYVKPDQENSQYSASSLHNTRQFIEC
2b8wB           PHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIR
1aldA           ------------------------------------------------------QYPALTPEQKKELSDI
3dfqA           ------------------------------------------------------SHPALTPEQKKELSDI
3bb1B           GFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAIGIWNKAIVAL
4dfrA           -----------ISLIAALAVDRVIGMENAM---------PWNLPADLAWFKRN-TLDKPVIMGRHTWESI
3cr7B           KDLGFSEADRNENIRRIAEVAKLFADSNSIAI---TSFISPYRKDRDTARQLHEVETGLPQRDPKGLYKK
3cioD           HGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRMRQLLEWANDHYDLVIVDTPPMLAVSD
2d4hA           GHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGTINQQAMVTELTHRIRSKSSPDESADFVSF
3dfoD           ------------------------------------------------------SHPALTPEQKKELSDI
3dfpD           ------------------------------------------------------SHPALTPEQKKELSDI
3bgwA           RLIVTAGSINAQKIKAARRDFA---------SEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQT
3dftD           ------------------------------------------------------SHPALTPEQKKELSDI
3dt7A           RAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPGVTITSWKNKEWRPQDE
1ek0A           EHTWDTAGQERFASLAPYYRNAQAALVVYDVTKPQSFIKARHWVKELDIIIALVGNKIDLQEGGERKVAR
3dfnA           ------------------------------------------------------SHPALTPEQKKELSDI
3bczC           KQVDPSITRRIFILGPSHHVPLSRCADIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEHSIEHLPYT
3bgwD           RLIVTAGSINAQKIKAARRDFAS---EDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPG
1drbA           -----------ISLIAALAVDRVIGM----------ENAMPWNLPACLAWFKRNTLDKPVIMGRHTWESI
1dvrA           LEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQMLKEQGTPLEKAIELKVDDELLV
1e9sL           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
3dftC           ------------------------------------------------------SHPALTPEQKKELSDI
1culC           AAMSNLVPPVELANPENQFRVD------------------------------------------------
3dfqD           ------------------------------------------------------SHPALTPEQKKELSDI
1afrA           PTSWAIWTRAWTAEENRHGDLLNKYLYLS-GRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQER
3dfpC           ------------------------------------------------------SHPALTPEQKKELSDI
3cbnA           RTTFEVTVDP----EIGETADCIIGVSSSDSISTLPDEKRAIARESLGYDEIRGYGHPELTLDHPTDIVC
1eilA           --------------------------------------LGFAVKDVPAWDHFLTKSVGLMAAGSAGDAAL
2czvB           SYLIYVESNDLRVIRYSIEKGVDAIISPNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERANLAW
1ak2A           TMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLI
1e9rD           RDKDIILNPYDQRTKGWSFF-------------------NEIRNDYDWQRYALSVVPRGKTDEAEEWASY
3dffA           --VLVYTVFAGAAQPPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHRVAHRHGRFLDSIYRKLPDGRWLT
2eg5G           KLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCSGLVTEIGTNKGSIYSSKASRLPV
3a00A           GKDYNFVSVDEFKSMIKNNEF----------IEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKS
6aldA           ------------------------------------------------------SHPALTPEQKKELSDI
3bh0A           RLIVTAGSINAQKIKAARRDFASEDWGKLSM---AIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPG
1e2iA           L--DQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYL
2ck3C           RSTVAQLVKRLTDAD------------------------AMKYTIVVSATASDAAPLQYLAPYSGCSMGE
3dfnD           ------------------------------------------------------SHPALTPEQKKELSDI
2dr3F           AQFGWDVKPYEEKGMFAM-------------------VDAFTAGIGKSKEYEKYIVHDLTDIREFIEVLR
1akeA           KQAKDIMDAGKLVTDELVIALVKEIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIV
2ausC           ----------------VIVKDDKAETNPKWGFPPD---KRPIELHIQYGVINLDKPPGPTSHEVVAWIKR
1dp0A           --------------------------------------KQLLTPLRDQFTRAPLDNDIGVSEATRIDPNA
3dfqC           ------------------------------------------------------SHPALTPEQKKELSDI
3bjdB           QGLKGDRQAYAAYQQLLY----VLSLSDDVATAQTRR-----WLARAIYRVEERFPAADLSRALEQEIAA
3a00B           GKDYNFVSVDEFKSMIKNNEF----------IEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKS
3c15C           TIVAAMSNLVPPVELANPENQF------------------------------------------------
3dymA           --------------------------------------------TPLRDQFTRAPLDNDIGVSEATRIDP
1e9rG           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
2dr3C           NMAQFGWDVKPYEEK--------------------GMFAMVDAFTAGIGEYEKYIVHDLTDIREFIEVLR
1av6A           NGLRDVTLVTRFVDEEYLRSKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPF
2awoA           RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAI
1adoA           ------------------------------------------------------SHPALTPEQKKELSDI
2bhvA           ---LRTITADKMIPALITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKGEYRLDIVW
3c14C           TIVAAMSNLVPPVEL-------------------------------------------------------
3ecpA           ARLVNVAAQLAKYSGKSITIS-----------------SEGSKAAQEFIRNPNVSAEAIRKAGAMQTVKL
3bpbA           ETEIIEETVQRFYPGKVERIEAPGTV-------EAGDIMMVGDHFYIGESARTNAEGARQMIAILEKHGL
1c9kC           AHWRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGDPEQWDYAAME---------RAIDDEIQIL
1e9sE           RDKDIILNPYDQRTKGWSFFNE---IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIG
1dw9A           LLRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGK-------
5dfrA           --------------------------------------IGPWNLPADLAWFKRNTLDKPVIMGRHTWESI
1d6jA           KDLGFSEADRNENIRRIAE-------VAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPF
2ccjA           PTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEE
1e2mB           ETIANIYTTQHRLGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALLCYPAARYLMGSM
3b55A           -----------------------------------------NQIAKWLEAHAKPLKTTNPTASLNDLKPL
3dfoC           ------------------------------------------------------SHPALTPEQKKELSDI
3ec1A           LESGATLYDTPGIINHHQMAHFVDARDLKIITPKREHPRVYQLNEGQTLFFGGLARLDYIKGGRRSFVCY
2dftA           EQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLAAEGVRRTGGNDRAEKYRALMAK
1e2mA           NIYTTQHRLDQGEISAGDAAVVMTSA----------QITMGMPYAVT-DAVLAPHIGGEAGSPPALTLIF
2dflA           FRWERIENMAKALGLDIDNVMN--------------NIYYIRAINTDHQIAIVDDLQELVSKDPSIKLIV
3bb1E           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLSFGKGIWNKAIVAL
2anbA           HGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDV-FLDIDWQGAQQIRQKMPHA
3bwdD           LRPLSYRGADVFILAFSLISKASYENVSKKWIPELKYAPGVPIVLVGTKLDLRDDKQFFIDHAVPITTVQ
2bbsB           ----FCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSGGQRARISL
1cr0A           EDLIGLHNRVRLRQSDSLKREI------------IENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAK
1cjuC           TIVAAMSNLVPPVELANP----------------------------------------------------
1e4vA           GKAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELI
2ancF           DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAIVNDDFDTALTDLKTIIR
3cnlA           NIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLKKGGVPDIERA
1e9sI           RDKDIILNPYDQRTKGWSFFN-------------------EIRNDYDWQRYALSVVPRGKTDEAEEWASY
2dr3D           AQFGWDVKPYEEKGM-------------------FAMVDAFTAGIGKSKEYEKYIVHDLTDIREFIEVLR
1eamA           ---ILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIIISDVRSPSTADLLSNYALQNVMISILNPVASSLK
2ancD           HGEHYFFVNHD-EFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHA
2dftC           IFATDGEIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGVYLEISAAEGVRRTGGDRAEKYRALMAK
2aumA           -PSSD----QTWQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLED
3dyoA           ----------------------------------------------DQFTRAPLDNDIGVSEATRIDPNA
1e2iB           RVLGASETIANIYTTQHRLDQGEIS------AGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPP
3ed8A           GPV--LLPDNHYLSYQTVLSKDPNE-----KRDHMVL-LEFVTAAG------------------------
3bm2B           ------ALELLIN-RRSASRLAEPAPTGEQLQNILRAGRAPDWHFFVERFSAVLEQGAIAAGSDDKAIDK
2aunB           --------------WQPIDGRVALIAPASAIATEVLE-ATLRQLEVHGVDYHLGARYRYLAGTVEQRLED
3bb1H           AGFTLNIIDTPGLIEGGYINDMALNIIK----------SFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKA
1bmfC           QKRSTVAQLVKRLTD----------------------ADAMKYTIVVSATASDAAPLQYLAPYSGCSMGE
2awnA           RGVGMVFQSYALEVINQRVNQV-------------AEVLAIGRTLVAEPSVFLLDEP-------------
2aunA           -PSSD----QTWQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLED
2aumB           -----------WQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTVEQRLED
3e8aC           TIVAAMSNLVPPVELANPENQ-------------------------------------------------
2c95B           LSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMT
2d2eA           DERARKGFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKALELLDWDESYLSRYLNEGEKKRNEI
1e2kB           ETIANIYTHRLDQGEISAGDAAVVMTSAQI--------------TMGMPYAVTDAVLAPHIGGEAHAPPP
3bv4A           --------------------------------------------------------PALTPEQKKELSDI
2cdnA           VEAKRYLDAGDLVPSDLTNELVDDRLNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSE
3bb1F           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYRVDNLDKLVAKAITDSFGKGIWNKAIVAL
1e2jA           LDQGEISAGDAAVVMTSANITMGMPYA-VTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYL
3b85B           EKLGFLPDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRG-RTLNDAFVILDEAQNTTPAQKFL---
1e2nA           ETIATQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCY
3di4A           VTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRHHCCHSNLTRALADHTGLPLHEAELVHD
2a1fD           ------------------------------------------------------------------QPIY
3c7kC           QYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGI
3d1mA           ------------------------------------------KQFIPNVAEKTLGASGRYEGKITRNSER
1cjaA           IADNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFHSIRDI-ITLYTGYDVGT
3cmvB           RKLGVDIDNLLCSQPDTGEQALEICDALARS-GAVDVIVVDSVA--ALTPKAEIGLAARMMSQAMRKLAG
1e9rB           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
2bv7A           GLRFIQVFLQSICDGERDENHP----------------NLIRVNATKAYEM-----ALKKYHGWIVQKIF
2bhvD           --LLRTITADKMIPAFLITPISSQIGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGYRLDIVW
1e2nB           YTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAGGEAGSPPALTLIFDRHPIAALLCYARYLMGSM
2a5vA           PSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAIS---------------------------------
3dvlD           RSFGWDLAKLVDEGKLFI-------------LDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSI
1e9sA           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
2a5vB           PSVLLGRRDGLSRVDEFEQRHVHETVA-------------------------------------------
3cueF           TAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEY
1b0uA           TRLTMVFQHFNLWSHMTVLENVAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSI
1azsC           TIVAAMSNLVPPVELANPENQF------------------------------------------------
2a1fC           ------------------------------------------------------------SQPIYKRILL
3brwA           HDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGATSEE
1bccF           WYYNAAFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQQILP---KEQWTKYEED
2ancB           HGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLD-IDWQGAQQIRQKMPHA
3cnnA           NIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLKKGGVPDIERA
3d1mB           ---------------------------------------LTPLAYKQFIPNVTLGASGRYEGKITRNSER
2dpyB           PDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMREIALAIGEPPATKGY
3cphA           GKKVKLRFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTA
1ckvA           ELLGRQFNVYDFLVDVSS----------------------------------------------------
1e2jB           ETIANIYQHRLDQGEISAGDAAVV-MTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHP---
2c5mD           ----------------------------------------------------------------KSCGLH
3c7kA           AIVRAMDT--------------------------------------------------------------
3bjqB           ----------------------------------------------------------------QARVV-
3dfdA           EAYKTEDPVEVAKRVLSVGGEYANWLNKAIEING------------------------------------
2dpyA           PDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAQREIALAIGEPPATKG-
3dkvA           LEAKSYIDKGELVPDEVTIGIVRERL--------------------------------------------
1e1qB           RSTVAQLVKRLTDADAMKYTIVVSQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQARPPGREAYPGDVF
2e85B           -----------------------------------------------------------IDGGSAPENDI
1e2lA           FTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPIFDRHPIAALLCYPAARY
2bbtB           IMPGTIKENIIGVSY------------DEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQRARISL
2bkeA           FRWERIENAKALGLDIDNVNNI----------------YYIRAINTDHQIAIVDDLQELVSKDPSIKLIV
1e2lB           ETIANIFT------TQHRLDQGEISAGDAAVVMTSAQITMGMPYAVT--DAVLAPHIGGEAGSPPALTLI
2e85A           ----------------SAVTDVLLCVNSMMGDDGA------GPLLAEKCAAAPKGNWVVIDGGSAPENDI
3bs4A           SRFGVDVIKYLENHRLAIVDTFGSFHGIMPGVYLEGMLSSETLPIKYAVEDHKKVWMDLNLFEGRELYGF
3bb1C           AGFTLNIIDTPGLIEGGYINDMALNIITIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVAL
1d8jA           ------------------------------------------GDTHPLTLDEILDETQHLDIGLKQKQWL
2b8tD           TGTSLPEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFNFKGEPFGPIAKLFTY
2a1fE           ------------------------------------------------------------------QPIY
2aexA           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2d3wD           EGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMPEDLLTRSVNVGFSGGEKKRNDI
3cr8B           -------------------------------------GTLVNLIDPE-KREALKHEALSLP-----SLDL
1e9sK           RDKDIILNPYDQRTKGWSFFN-------------------EIRNDYDWQRYALSVVPRGKTDEAEEWASY
2d3wC           EGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEDLLTRSVNVGFSGGEKKRNDI
2d7vA           EFIANSVETE------------------------------------------------------------
2an9A           HGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDV-FLDIDWQGAQQIRQKMPHA
1e2hA           NIYTTQHRLDQGEISAGDAAVVSAQITMGMPYAVTDAVLAPHIGGEAGAALLCYPAARYLMGSMTPQAVL
3bb1G           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAKLVAKAITDSFGKGIWNKAIVAL
3dm5B           QLRQLLDRYHIEVFGNPQEKDA----------------IKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKA
1d6aA           ISTAIHDAKNGVLPKPLELVDA--------SGAKWIVLRVDEIKPDVALLNYVGGSC-------------
1cjvC           V--AAMSNLVPPVEL-------------------------------------------------------
3cbqA           KEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDARSREVSL
2d7vB           EFIANSVETE------------------------------------------------------------
3cd9A           LLPDNHYLSTCSALSKDPNEKR------------------------------------------------
2bhvC           LITPISSQIAGKV-IAQVESDI--------------FAHMGKAVLIPKGSKVIGYYSNNNKMGERLDIVW
1ckeA           SHLDVRFVSTNGNLEVILEGED-------VSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLI
2a78A           EEVEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSV
3do6A           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1d2zD           ALISLELLE-------------------------------------------------------------
3b9qA           QLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAVGKIVS
2awoD           RGVGMVEPSVFLLDEPLDAALRVQMRIEISRLHKRLEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRF
3cddA           WVPSYDESTITISSGRDKTAD--LVDCSIDYPSGQFNNQADIVCKPFGIKNTDVGEPFQIEQGETPHELL
3cqcA           ALIPQPTFTEKVAHEHKEKKYE-------------MDFGIWKGHLDALTADVKEKMYNVLLFVDGGWMVD
3c85A           GKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHLAPHHQGNQTALEQLQRRNYKGQIAAI
1delA           ANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKI
3bb1D           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKALQVVRSGASL
1chdA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3cddE           GERVITGYVDDWVPSYDESTITGRDKTADLVDCS--IDYPSGQFNNQTLTQIADIVCKPF--GIKVIVNT
2bwjF           ----------------------------------------------------------------------
1agpA           ETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSQIKRVKDSDDVPMVLVGNKCDLAARTVES
2atjA           ------------------------NSARGFPVIDRMKAAVESACPRADLLTIAAQQSVTLAGGPSWRVPL
1e6vC           ----------------------------------------------------------RKYMNPNYELKK
2c9oA           TELMENFRRAIGLRIKETKEVYEGEVTELTPCHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYI
2ax4B           LGFSPGDREENIRRIAEVAKLFADAITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKG
2ax4A           LGFSPGDREENIRRIAEVADAGLVCITSFISPFAKDRENARKIHESAGLNICESRDVKGLYKRARAGEIK
2bwjC           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3dsrB           QYFMSDFEKTGALERAVVFLN-------------------------------------------------
2dwqB           TFAKGERVPPVVPTHVEFVDIAGLV---------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1dapA           QS--------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAW
3dmdC           MDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPIL
3b5jA           ARALVNNPKILIFDEATSALDYESEHVIMRNM--HKICKGRTVIIIAHRLS-TVKNADRIIVMEKGKIVE
3dmdB           MDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPIL
3cmvG           LKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEG
3cmvH           LKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEG
2bifA           IFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGS-PDYVNRDSDEATEDFMRRIECYENSYESLDEEQ
2dwoA           ILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISS-PDYKDCNSAEAMDDFMKRISCYEASYQPLDPDK
3c95A           HRRQVFTP--EFLQGYADELQMLVQQYAD-------DKEKVALL--------------------------
2c03B           MGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIY
2ccgB           VRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEKEGYQEIIHNESQRFKSVNADQPLE
2ccjB           VRALNEFAINGLYPDLTIYLNVSAEVGRERIIK-NNRLDQEDLKFHEKVIEGYQEIIQRFKSVNADQPLE
2d3wB           LQMAVLEPELCILDESDSL-DIDALKVVADGVNSLRDGKRSFIIVTHY-RILDYIKPDYVHVLYQGRIVK
2ccgA           VRALNEFAINGLYPDLTIYLNVSAEVGRERII-KNSRDQNRLDQEDLKFHEKVIEGYQEIIHNESQRFKS
1bifA           IFNFGEQNGYKTFFVESICVDPEVIAANIVQV-KLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEEQ
3cmvC           LKQSNTLLIFINQGGNALKFYASVRLDIRRIKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINF
2dwpA           ILHFAKENDFKAFFIESVCDDPTVVASNIMEVK-ISSPDYKDCNSAEAMDDFMKRISCY--EASYQPLDP
1e9cA           DVGLPKPDLVLFLQLQLADAAKRGAFGH-----ERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIE
3b60A           ARALLRDSPILILDEATSALDTESERAIQAA--LDELQKNRTSLVIAHRL-STIEQADEIVVVEDGIIVE
2czvA           KLVEKYKVRRFLTSSAQEKWDVRYPRDLISLG----VVIGMEIPQAKASISMYPE---------------
2a2zD           FGQSLELDGIIYLQATPETCLHRIYLRGRNYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNED--
2b8tA           ADKITKLTAICNECGAEATHSLRKIDGK-------HADYNDDIVKIGC-QEFYSAVCRH-HHKVPNRPYL
1e9fA           DVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFHLNWKMVDASKSIEAVHEDIRV-LSEDAIATAT
3cmvA           AALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVK
2c61B           PILSMPGDDITHPIPDLSGYITEGQIVVA------RELHRKGIYPPINVLPSLSRLMNSGIGAGKTREDH
4dcgA           APSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKI--VRNKVVVNFDYPNQEYDYFHMYFMLR
1e2dA           VGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQER------ALRCFHQLMKDTTLNWKMVDASKSIE
2a30D           FGQSLELDGIIYLQATPETCLHRIYLRGRNYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEY--
1e9dA           DVGLPKPDLVLFLQLQLADAAKRGAFGHE-----RYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIE
1e69A           ALLFALMEPFYVLDEVDSPLDDYNAERFKRLLKE--NSKHTQFIVITHNKI-VMEAADLLHGV-------
1d1cA           ALHLAGPESFNYLNQSGCVDIKGVSDSEEFKI---TRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEK
2cjwB           CKFIETSAAVQHNVKE--------------------LFEGIVRQVRLRRDS-KEKNERRLAYQKRKE---
3eiuB           PILSMPGDDITHPIPDLSGYITEGQIVVA------RELHRKGIYPPINVLPSLSRLMNSGIGAGKTREDH
3eiuA           PILSMPGDDITHPIPDLSGYITEGQIVVARE------LHRKGIYPPINVLPSLSRLMNS-GIGAGKTRED
3dm5A           IEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIK
2cgtH           GAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPG
2a5gA           KLGLTRIRDRNWYVQPSCATSGDGLYEGLTWL--------------------------------------
2cckA           GVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSREDLKFHEKVIEGYQEIIRFKSVNADQPLE-
2a2zA           YQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKT-
3cmxA           ALKFYA-SVRLDIRRIGAVKEGENVVGSETRV------KVVKNKIAAPFKQAEFQILYGEGINFYGELVD
2akaB           LMQFVTKENCLILAVSPANSDLANSDALKIAKEV--DPQGQRTIGVITKLDLMDEGTDARDVLENKLLPL
1e98A           DVGLPKPDLVLFLQLQLADAAKRGAFGHERYE-----NGAFQERALRCFHQLMKDTTLNWKMVDASKRIE
2bbsA           ARAVYKDADLYLLDSPFGYLDVLTEKEIFE--SCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYF
3a1wA           IDRYELQKHLGIPVVFTSSVTGEGLEELKEKI--------------------------------------
3cmvE           LKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEG
2bc9A           LYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADGQPLTLTYSLKLKKGTSQKDETFNLPRLCIRK
2axpA           LYREVSNAGLHTYSWDTGQWSSDEIAKDI-----------------------------------------
2a30B           FGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEY--
3czpB           EREKTPYKRYKITEEDWRNRDKDAVGDVD----------RTSTEIAPWTLVEANDRFARVKVLRT-----
2c03A           MGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHTGKPIYF
1bg0A           DHFLFKEGDRFLQTANACRYWPTGRGIFHTFLVWVNEEDHIISMQKGGDLKTVYKRLVTAVDNIESKLPF
2c9yA           RRITGRLIHPKSGRSYHEEFNPPKEPMKD---DITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRK
1e9rA           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDP
1aroP           TTLLPKMIARINDWFEEVKAKRGKRPTAFQFL-QEIKPEAVAYITIKTTLACLTSADNTTVQAVASAIGR
1e9sG           GRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLSLFAGSNEASKALTSARFVLSDKLPEH
3b85A           GDGLRLV-RHILRGVDDVHFSELTSSDVVR----------------------------------------
2ctsA           TALNSESNFARAYAEGIH----------------------------------------------------
1e9sJ           GRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTESLFAGSNEASKALTSARFVLSDKLPEH
2dr3A           QAIRDINAKRVVVDSVTTLYINKPAMAIILQLKRVLAGTGCTSIFVSQVSGFGEHGVDGIIRLDLDEIDG
2b8wA           SLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQD
2awnC           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2a2zB           FGQSLELDGIIYLQATPETCLHRIYLRGLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNED--
3adkA           KRLLKRGETSGRVDDNEETIKKTYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFS---------------
2a5jA           EEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL--------------------------
1e9sF           GRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLELAESLFAGSNEASKALTSARFVLSDKLPEH
3b2qA           AR---NEVPGRRGYPGYMYTDLATLYERAGIVKG-AKGSVTQIPILSM-PGDDITHPIPDLSGYITEGQI
2c04A           MGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHTGKPIYF
2dr3E           QAIRDINAKRVVVDSVTTLYINKPAMAIILQLKRVLAGTGCTSIFVVSVGPGVEHGVDGIIRLDLDEIDG
1e4yA           KEAGINVDYVLEFDVPDELIVDRIVGRRVHA---PSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
1e9sD           GRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLELAESLFAGSNEASKALTSARFVLSDKLPEH
1e9sB           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD----------------------
1e2kA           TLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR-----------
3cmtD           GNALKFYASVRLDIRRIGAVKEGENVVGSET-----RVKVVKNKIAAPFKQAEFQILYGEGINFYGELVD
2awnD           PLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLP
421pA           RQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH-------------------------------
2a30A           FGQSLELDGIIYLQATPETCLHRIYGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEY--
2b8tB           ADKITKLTAICNECGAEATHSLRKIDGK--------HADYNDDIVKIGCQEFYSAVC-RHHHKVPNRPYL
2bdtA           ELVEEFE--SKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI---------------------------
3d3kA           AWANQNRAPVLSIDPPVHIDAKWSLALGLPLP--LGEHAGRIYLCDIGIPQQVFQEVGINYHSPFG----
1dekB           VFDDEG-KESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYD
1cr4A           YMRSGLGCDVIILDHISIRKM---IDNLMTKLKGFAKSTGVVLVVICHLKGALRQLSDTIIALERNQLVL
1e2fA           DVGLPKPDLVLFLQLQLADAAKRGAFGHERYE----NGAFQERALRCFHQLMKDTTLNWKMVDASKSIE-
3b2qB           PILSMPGDDITHPIPDLSGYITEGQIVV------ARELHRKGIYPPINVLPSLSRLMNSGIGAGKTREDH
3cddC           ARLAKQR-GVLLTSDTFGNLVITRASKTKAGV---SLILGDNVKAARGR-FSWRQRFSKFTIKADSAGLP
2akaA           LHLAGPESFNYLNQSGCVDIKGVSDSEEFKI----TRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEK
1cfrA           IRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYAELEHIKSFLSVKTTFRPDRRLQLAHEGSLMK
3cr7C           SA-PYEAPANPEVHVKNYELPVQDAVKQI-----------------------------------------
3d7wA           ARS--ILILIQMISEAARFNP--ILWRARQYI-----NSGASFLPDVYLETSWGQQSTQVQHSTDGVFN-
1e3mA           NILHNATEYSLVLDEIGRGTSTYDGLSLAACAENLANKIKALTLFATHYFELTQLPEKEGVANVHLDALE
3dt2A           EPCAHPNSRFCTPASQCPIIDPAWESPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGATAAAEHKGKVIM
1dekA           SVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVR--
2axzC           VDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFEHLISINGYYDLEIYQFLTDKNIDSYLNAVNI
1e0jA           CDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLR
1dhjA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
3d3qA           DKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQYDTLLIGIESRETLYLRINKRVDILGHGLFNE
3dt4A           EPCAHPNSRFCTPASQCPIIDPAWESPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGATAAAEHKGKVIM
3clvA           LEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNII-----------------------------
3cddF           SEIGRYRPLIIVNEEVTTAEGAAKRGQWERQR--SIGKSNAEYTVTGWQTGKLWNINTLVPVIDEIGLDE
1dhiA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
3czpA           EREKTPYKRYKITEEDWRNRDKAVGDVDRTS-----TEIAPWTLVEAND-----KRFARVKVLRT-----
1e0jB           CDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLR
2d0kA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAAGDVPEIFVIGGGRVYEQFLPKAQKLYLTHIDAEVE
1e3mB           NILHNATEYSLVLDEIGRGTSTYDGLSLAACAENLANKIKALTLFATHYFELTQLPEKEGVANVHLDALE
3cm0A           VRRILREGRSDDNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRA-----------
1e3aB           ETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSM-LKRTVVAAVPMPFDKWYSASGYETTQDGPTGSLNI
2awnB           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2bjbA           GSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEPDLTNAVAFLSA-AVVSGGTVRI
3cddD           AR-LAKQRGVLLTSDTFGNLVITRASKTKAGVS---LILGDNVKAARGRFSWRQR---------------
3cr7A           SAPYEAPANEVHVKNYELPVQDAVKQIIDYL---------------------------------------
2bhjA           APRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITVFPQRSDGKHDFRLWNSQLIR
1e9sM           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS--------
2c0bL           QIESAFQREVRLPSGGSIVIDSNSARDIEETAFNTNLADEIARQLRLRGGLIVIDFIDMTPVRHQRAVEN
3be4A           GRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAPLVKFYEDLGILKRVNAKLPP--
2cckB           TIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIRFKSVNADQPLENVVEDTYQ---TIIKYL--
2d62A           GRAIIR-RPKVFLDEPLSNLDAKLRVKRAEL-KKLQRQLGVTTIYVTH---DQVEATGDRIAVNKGELQQ
3c8uA           CRVAIIEGNYLLFDAPGWRDLTAIWDVSIEVPADLEARLVQRWLDHGLNHDAAVARAQGNDLANARAIEA
3cmwC           ARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENV
2dr3B           QAIRDINAKRVVVDSVTTLYIPAMARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGVEHVDGIIRL
3bb1A           THAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL--KSDIPVVLIENSGRCNKNDSDEK--VLPNGIAWI
1e59A           PRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERV-IIAAHGNSL-RALVKYLDNMSEEEILE
1e2gA           DVGLPKPDLVLFLQLQLADAAKRGERYE---------NGAFQERALRCFHQLMKDTTLNWKMVDASKSIE
2b8tC           ADKITKLTAICNECGAEATHSLRKIDGK--------HADYNDDIVKIGCQEFYSAVCRHHHKVPNRPY--
1ai4B           ETLTRWDGINLLNDDGKTWQQPGSAILNV-WLTSMLKRTVVAAVPMPFDKWYSASGYETTQDGPTGSLNI
3d3qB           NNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLLIGIESRETLYLRINKRVDILGHGLFNE
3da4A           GEIHIKE---------------------------------------------------------------
1dkiA           ENFGYNQSVHQINRGDFSKQDWEAQIDK-------ELSQNQPVYYQGV------GKVGGHAFVIDGADGR
4atjA           GRRDSLQAANANLPAPFFTL-PQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDR-LYNFSNTGLP
2bkiA           LHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAM--KKIGLD
1e2hB           TPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVR-----------
2c9oC           HRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGIN
1e6cA           MEAVLREREALYQDVAHYVVDATQPPAAI-----------------------------------------
2ahwD           IKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALV----------------------
3dlbB           VAWV---ADPKDPRKPIPHLTGLLVPVGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLS
3bk7A           AATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDR-LIVFEGEPGR
2d4uA           LGAGKIN---EFFDQPTQGYQDGFEKQYVAYMEQNDRLHDIA-VSDNNA---------------------
3dm9B           NLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPIL
2b92B           LRDFSLDLEADGQPLTPDEYLTYSLKLKKGTS-QKDETFNLPRLCIRKFFPKKKCFPVHRRKLAQLEKLQ
2c4rL           QIESAFQSGGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIAR-QLRLRDLGGLIVIDFIDMTP
2drcA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
1d6jB           QRAPYEAPANPEVHVKNYELPVQDAVKQI-----------------------------------------
2boeX           AQAAGKIPILVVSNAPGRDCGGGAPRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAY
3crmA           QLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAE--
2bkhA           LHSSPDNFRYLNRGCTRYFANKETDKQLQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEK
3czjA           WVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASD
2c7cH           GAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPG
2d4hB           IRKFFPKKKCFVFDRPVHRRKLAQLEKLQDELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESL
3dtbB           EPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFPAGVPLVYEALSWQH-GVFVGAAMRSEAKVIMH
1e9rF           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDP
3cmuA           MSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYA---------------------
2bofX           FAAGLKNRPAYIIVEPDLISLMMQHVQQEVLETMAYAGKASSQARIYFDAGHSAWHSPAQMA--------
1cjtC           ----------------------------------------------------------------------
3ch4B           GLDNFGDFDWVIENHGVEQRLEEQLENLIEF---------------------------------------
3cr7D           SAP-YEAPANPEVHVKNYELPV--QDAVKQII--------------------------------------
3dauA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
2ahvA           IKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMMQVQKMVKK
3dt4C           EPCAHPNSRFCTPASQCPIIDPAEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVG-------------
1dg3A           LRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKK---KCFVFDRPVHELDPEFVQQ
1cr1A           LAYMRSGLDVIILDHISIRKM---IDNLMTKLKGFAKSTGVVLVVICHLKTDLRQLSDTIIALERNQL--
1bglA           WVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASD
2d4uB           LGAGKIN---EFFDQPTQGYQDGFEKQYVAYM--------------------------------------
2cvfA           VINQVHFDSRTEMTKPVAEQTLGYRCKDI-LRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERG----
2bx2L           QIESAFQREVRLPSGGSIVIDSTEALTAIDINS---ARGDIEETAFNTNLEAADEIARQLRLRDLGGLIV
1e9sH           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDP
1cs4C           ----------------------------------------------------------------------
2awoC           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
1accA           DESVVKEAHREVINSSTEGLLLNIDKDIRKI------LSGYIVEIEDTEGL-KEVINDRYDMLNISSLRQ
2c61A           AARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITH-PIPDLSGYITEGQIVVA
3dhwC           ARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIE
1draA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
2a1fF           KLSGE-----ALQGEDGLGIDPAILDRMAVEI-KELVEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDH
3dfnC           AHRIVAPGKGILAANESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
1e9rE           GRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLSLFAGSNEASKALTSARFVLSDKLPEH
1cr2A           YMRSGLGCDVIILDHISIRKMIDNLMTKLK---GFAKSTGVVLVVICHKSGALRQLSDTIIALERNNL--
2bwjA           NRLLQMSRSSLPVDDTTKT-IAKRLEAYYRASIPVIAYYETKTQLHKINAEPEDVFLQLCTAIDSI----
3d31A           ARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARIMADRIAVVMDGKLIQ
1dyhA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
3bo6B           LESRLSESGLMPGQYPESDVHPENWKYVSYRN-ELRSGRDGGEMQ--SQALREEPFYRL---MAE-----
2b8wB           SKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFV
1aldA           AHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPCIGGVILFHETLYQKA
3dfqA           AHRIVAPGKGILAASESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
3bb1B           THAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLA-SDIPVVLIENSGRCNSDEKVLPNGIAWIPHLVQ-
4dfrA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
3cr7B           AREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYL--------------------------
3cioD           AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILGVIKRASTAYSYG-------------
2d4hA           FPDFVWTLRDFSLDLEADGQPLTPDETSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHR-RKLAQLEKLQ
3dfoD           AHRIVAPGKGILAANESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
3dfpD           AHRIVAPGKGILAANESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
3bgwA           KRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKVVIALSQLSRQVEQRQDKRPMLSDLRESG
3dftD           AHRIVAPGKGILAASESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
3dt7A           EPCAHPNSRFCTPASQCPIIDPAWESPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGATAAAEHKGKVIM
1ek0A           GEKLAEEKGLLFFE--TSAKTGENVNDVFLGIGEKIPLK-------------------------------
3dfnA           AHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFY-RQLLLTADDRVNPCIGGVILFHETLYQKA
3bczC           AKAESHKDEFTIIPVLVGALSESKEQEFGKLFVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKGSIIE
3bgwD           KRVIVMIDYLQLLEPAKANDSRTNQIQISRDLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESG
1drbA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
1dvrA           ARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIV---DFYKK
1e9sL           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD----------------------
3dftC           AHRIVAPGKGILAASESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
1culC           ----------------------------------------------------------------------
3dfqD           AHRIVAPGKGILAASESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
1afrA           ATFISHGNTARQAKEHGDIKLAQICGTI-------AADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMR
3dfpC           AHRIVAPGKGILAANESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
3cbnA           RKSDYICSRTLIRADKAAFDLDENLVRDL---------RKGRELKVEIIVEYEGH---------------
1eilA           YRADQRAWRIAVQPGELDDLAYGLEVDDAAALERMADKLRQAGVAFTRGDEAL--MQQRKVMGLLCLQDP
2czvB           KLVEKYKVRRFLTSSAQEKWDVRYPRDLISL----GVVIGMEIPQAKASISMYPEII-------------
1ak2A           RRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRSDDNKKALKIRLEAYHTQTTPLVEYYSKRG--
1e9rD           GRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLELAESLFAGSNEASKALTSARFVLSDKLPEH
3dffA           AHVEGRQKLAVNDHSPDSDHDL--VGEVADDIRSIIDEFDPTLVVTCA---AIGEHPDHEATRDAALFAT
2eg5G           QKAYLDQFTKDFTTFL----RIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEK
3a00A           VKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKA--YKELKDFIFAE----------------------
6aldA           AHRIVAPGKGILAADESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
3bh0A           KRVIVMIDYLQLLEPAKANDSRTNQISISRDLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESG
1e2iA           MGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLA------------------------------
2ck3C           YFRDNGKHALIIYDDLSKQAVA--YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTA
3dfnD           AHRIVAPGKGILAANESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
2dr3F           QAIRDINAKRVVVDSVTTLYINAMARSIILQLKRVLAGTGCTSIFVSQVSGGVEHGVDGIIRLDLDEIDG
1akeA           DRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGELVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVA
2ausC           ILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHL--HGDVPEDKIRAVMKEFEGEI
1dp0A           WVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASD
3dfqC           AHRIVAPGKGILAASESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
3bjdB           QSRERHPSQYVSGSASRAQLQVFLRHQWFRTFRL--YRDAADLLVNLTD-VDEAAALARYLYGELGEEDE
3a00B           VKAIPELNARFLFIAPPSGAHDKVIVNDD----LDKAYKELKDFIFAE----------------------
3c15C           ----------------------------------------------------------------------
3dymA           NAWVWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASD
1e9rG           MRELFHWTTIATFDDLRGFLEGTLAESL------------------------------------------
2dr3C           QAIRDINAKRVVVDSVTTLYINKPARSIILQLKRVLAGTGCTSIFVSQVSGV-EHGVDGIIRLDLDEIDG
1av6A           PDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYYLNKIVRNKVVVNFDYPN
2awoA           GRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
1adoA           AHRIVAPGKGILAADESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
2bhvA           SRIITPHGINIMLTNAYNGLVGELIERNFQRYGTSAFGDYLLMQLMRQSGMGINQVVNQ-----------
3c14C           ----------------------------------------------------------------------
3ecpA           AQEFPE----LLAIEDTTSLSY--RHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWM
3bpbA           SGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDF-NIIEIPEEESYAANC----IWVNERVIMP
1c9kC           IAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAG----------RVNQRLAAAADEVWLVVSGIG--
1e9sE           TPSMRELFHWTTIATFDDLRGFLEGTLA------------------------------------------
1dw9A           ----------------------------------------------------------------------
5dfrA           GRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
1d6jA           VEVYVDVPVEAPYEAPANPNYELPVQDAVKQI--------------------------------------
2ccjA           VRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLDQEDLKFHEKVIEGYQEIIHRFKSVNADQPLE
1e2mB           TPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRYLQCGGSWRED
3b55A           KN--VGSASIVGLGEATHGAHE--VFTKHRIVKYLVSEKGFTNLVLEEGWDRALELDRY-VLTGKGN--P
3dfoC           AHRIVAPGKGILAANESTGSIAKRLQSIGTEN-TEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
3ec1A           MANELT-VHRTKLEKADSLYANQLGELLSPPS---KRYAAEFPPLVPRSLSV-KERKTDIVFSGLGWVTC
2dftA           RAPLYRRVATMRVDTNRRNPGAVVRHIL------------------------------------------
1e2mA           DRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQ----------
2dflA           VDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVMHTLYHVPGIRIQLKKSRGNR
3bb1E           THAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENS--GRCNKNDSDEKVLPNGIAWI
2anbA           RSIFILPPSKIELDRRLRGRGQDSEEVMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSR
3bwdD           GEELKKLIGAPAYIECSSKSQENVKGVFDAAI--------------------------------------
2bbsB           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKL-MANKTRILVTSKME-HLKKADKILILHEGSSYF
1cr0A           LAYMRSGLDVIILDHISIRKM---IDNLMTKLKGFAKSTGVVLVVICHDLRALRQLSDTIIALERNQLVL
1cjuC           ----------------------------------------------------------------------
1e4vA           VDRIVGRRVHAPSGRVYHVKTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVA
2ancF           AERLRMSRQKQRHDALISKLL-------------------------------------------------
3cnlA           LMLFFTEVGRVSFERPED----------------------------------------------------
1e9sI           GRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESAGSNEASKALTSARFVLSDKLPEH
2dr3D           QAIRDINAKRVVVDSVTTLYKPAMARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGVEHVDGIIRL
1eamA           WRCPFPDQWIKDFYIPHGNKMLQPFAPSSAEMRLLSIYTGENMRLTRVTKSDAVNYAKKMYYLNKIVRNK
2ancD           RSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSR
2dftC           RAPLYRRVATMRVDTNRRNPGAVVRHIL------------------------------------------
2aumA           LHNAFDMPDITAVWCLRGGYGCGQLLPG-LDWGRLEAASPRPLIGFADISVLLSAFHRHGLPAIHGPVA-
3dyoA           WVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASD
1e2iB           ALTLIFDRHPIAALLCYPAARYLMGSMTPQAV--------------------------------------
3ed8A           ----------------------------------------------------------------------
3bm2B           ARNAPFRAPLIITVVAKVPRWEQ--ESAGCAVAQAAVAQGIWRSGALTESPVVREA----FGCREQDKIV
2aunB           LHNAFDMPDITAVWCLRGGYGCGQLLPGLDWG-RLEAASPRPLIGFSDISVLLSAFHRHGLPAIHGPVA-
3bb1H           ITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDSDIPVVLIENSGRCNK
1bmfC           YFRDNGKHALIIYDDLSKQAVA--YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTA
2awnA           ----------------LSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQ
2aunA           LHNAFDMPDITAVWCLRGGYGCGQLLPGLDWG-RLEAASPRPLIGFSDISVLLSAFHRHGLPAIHGPVAT
2aumB           LHNAFDMPDITAVWCLRGGYGCGQLLPGLD-WGRLEAASPRPLIGFADISVLLSAFHRHGLPAIHGPVAT
3e8aC           ----------------------------------------------------------------------
2c95B           QRLLKRGETSGRVDDNEETIKETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFS---------------
2d2eA           LQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVHVMMDGRVVA
1e2kB           ALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDL
3bv4A           AHRIVAPGKGILAADESTGSIAKRLQSIGTE-NTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA
2cdnA           EVLLERRGRADDTDDVILNRMKVYRDETAPLLEY--YRDQLKTVDAVGTMDEVFA---------------
3bb1F           THAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL--KKDIPVVLIENSGRCNKNDSDEK--VLPNGIAWI
1e2jA           MGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRERLDLAMLAAIRRVYGLLANTVRYLQCGGSWR
3b85B           -TRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSDVVRHQLVGHIVDAY-----------------
1e2nA           PAARYLMGSMTPQAVL-----------AFVALIPPTLPGTNIVLGALPEDRHIDRLAKR-----------
3di4A           VLNVFCTTGQYFKASPVRPGDYLEFFAEIDLL------GNLSACPGGDCSSEASCHPLLVEIFAPAEGLG
2a1fD           KRILLKLSGEALQGEDGLGIDPAILDRMAVE-IKELVEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDH
3c7kC           QECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRS
3d1mA           FKELNYNPDIIFKDEENTGADRLMTQRCKDKLSVMNQWPGVKLRVTEGWDEDGHHSEES--LHYEGRAVD
1cjaA           EGSISMQEGFLATVRECASFDLDAFERELLSKCHNLSISPQAIPFILR----------------------
3cmvB           NLKQSNTLLIFINQGGNALKFYASVRLDIRR--IGAVKEGENVVGSETRVK-VVKNKIAAPFKQAEFQIL
1e9rB           MRELFHWTTIATFDDLRGFLEGTLAESL------------------------------------------
2bv7A           QAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYT-ATIDVIYEMYTRMNAE-------------
2bhvD           SRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPTFGDYLLMQLMRQSGMGINQVVNPIVVIREGSRVF
1e2nB           TPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQL
2a5vA           ----------------------------------------------------------------------
3dvlD           D-----SVTSVFQQYDA---SSVVRRELFRLV-ARLKQIGATTVMTTERIEEYGPIARYGVFVSDNVVIL
1e9sA           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD----------------------
2a5vB           ----------------------------------------------------------------------
3cueF           DVAKEFADANKMPFLETSALDSTNVEDAFLTM-ARQIKESMS----------------------------
1b0uA           ARALAMEPDVLLFDEPTSALDPELVGEVLR-IMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEE
1azsC           ----------------------------------------------------------------------
2a1fC           KLSG-----EALQGEDGLGIDPAILDRMAVEIK-ELVEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDH
3brwA           ELFSTN-EESPAFVEFLEFLGQKVKLQDFKGFRGGLGQTGTESVYCNFRNKEIMTEGDAQQLQRKRHIGN
1bccF           VPYLEPYLKEVI----------------------------------------------------------
2ancB           RSIFILPPSKIELDRRLRGRGQDSEEVIAKRVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSR
3cnnA           LMLFFTEVGRVSFERP------------------------------------------------------
3d1mB           FKELTPNYDIIFKDEENTGADRLMTKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVD
2dpyB           PPSVFAKLPALV----------------------------------------------------------
3cphA           DQGEALAKELGIPFIESSAKNDEIFFTLAKLIQEKIDSNKLV----------------------------
1ckvA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2c5mD           VTSIKID-PYINIDAGLTKDNNLTTGKIYQYVINKERYLGKTVQVVPHITDAIQEWVMRQALEPQVCVIE
3c7kA           ----------------------------------------------------------------------
3bjqB           --------DPILSTHARGYRQSTLIGKKLFP-VAPVAQYGGKILTFGKELYNTKRNTKRIDFGYEGDPYS
3dfdA           ----------------------------------------------------------------------
2dpyA           ---YPPSVFAKLPALVERAGNGIHGGGSITAFY--------TVLTEGDDQQDPIADSARAIL--------
3dkvA           ----------------------------------------------------------------------
1e1qB           YLHSRLLERAAKMNDAFGGGSLTALPVIET------QAGDVSAYIPTNVISITDGQ-----IFLETELFY
2e85B           VAIRLRPTRLLIVDATDMGLNPGEIRII------DPDDIAEMFMMTTHNMPLNYLIDQIGEVIFLGIQPD
1e2lA           LMGSMTPQAVLAFVALIPPTLPGTNIVLGAL---------------------------------------
2bbtB           ARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK--MEHLKKADKILILHEGSSYF
2bkeA           VDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQ---VVPGIRIQLKKSRGNRRIA
1e2lB           FDRHPIA-ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPNIVLGALPEDRHIDRLAKR-----------
2e85A           VARELRPTRLLIVDATDMGLNPGEIRII------DPDDIAEMFMMTTHNMPLNYLIDQIGEVIFLGIQPD
3bs4A           AISMSGYLEVFTPEETLRYLE-----TSAEVRYGHPAYKKYPRGTNFWLWEGDKRVLLSVYRRADYVL--
3bb1C           THAQFSPPDGLPYDEFFSKRSEALLQVVRS--GASLKSDIPVVLIENSGRCNKNDSDEK--VLPNGIAWI
1d8jA           MTEALVNNPIEVIDGKYAFKPKYNVR--------------------------------------------
2b8tD           ADKITKLTAICNECGAEATHSLRKIDGK-------HADYNDDIVKIGC-QEFYSAVCRHHHKVPNRPYLN
2a1fE           KRILLKLSGEALQGEDGLGIDPAILDRMAVE-IKELVEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDH
2aexA           ------EDELAHRCSSFMAPPVTDLGEMELLILETQAQVCQALAQVDGGANFSVDRWERKEGGGGGCVFE
2bwjB           ----------------------------------------------------------------------
2d3wD           LQMAVLEPELCILDESDGLDIDA-LKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVK
3cr8B           DWQQQCE-LEMLMTGAYSPLTGFMTRAQCARVDDGSFWPSPITLTSRDRALADRRPGERLALR-------
1e9sK           GRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLSLFAGSNEASKALTSARFVLSDKLPEH
2d3wC           LQMAVLEPELCILDESDDIDALKVVADG---VNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVK
2d7vA           ----------------------------------------------------------------------
2an9A           RSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSR
1e2hA           AFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYG--LLANTVRYLQCGGSWR
3bb1G           THAQFSPPDGLPYDEFFSKRSEALLQVVRSG----ASLSDIPVVLIEN-SGRCNKNDSDEKVLPNGIAWI
3dm5B           LIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIK
1d6aA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3cbqA           EEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRR------------------------------
2d7vB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
2bhvC           SRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPLLLSTLTGLLIGITGDYLLMQLMRQSGMGINQVV-
1ckeA           ADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTLS--
2a78A           EEAKNRAEQWNVNYVETSAKTRANVDKVFDLMREIRARKME-----------------------------
3do6A           ----------------------------------------------------------------------
2b0lC           ---HMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVVIVNALRKLESAGVIESRSLGM
2bwjD           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3b9qA           GAP----------NEILLVLDGNTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCVVSVVEELGIPVK
2awoD           VAGFIGSPKMNFLPVKVTATAIDQVQVE-------LPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLP
3cddA           AR-LAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGD---NVKAARGRFSWRQRFSKFTI---------
3cqcA           VREDAKEDHE-----RTHQMVLLRKLCL-----PMLCFLLHTILHSTGQYQECLQLADM-VSSERHKL--
3c85A           AEYP-DQLEGLLESGVDAAFNI------------------------------------------------
1delA           TDVINNIEDQWSVRRLMQAL--------------------------------------------------
3bb1D           KKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPH--LVQTITEVALNKIFVDKNLI--------------
1chdA           ---LLSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITQHMPPGFTRSFAERLNKLCQISVKE
2c9gA           ----------------------------------------------------------------------
3cddE           DVGEPFQRIQIEQGE--TPHELLAR---------------------------------------------
2bwjF           ----------------------------------------------------------------------
1agpA           RQAQDLARSYGIPYIETSAKTRDAFYTLVREI--------------------------------------
2atjA           GRRDSLQLANANLPAPFFTLP-QLKDSFRNVGLNR--SSDLVALSGGHTFGKN-----------------
1e6vC           LREIPDEDIVRLMGHREPGEEYPSV---------------------------------------------
2c9oA           EANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANGEINKVVNKYIDQGIA
2ax4B           LYKRARAKGFTGIDSDYEKPETP-----------------------------------------------
2ax4A           GFTGIDSD--------------------------------------------------------------
2bwjC           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3dsrB           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
2bwjE           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3ci2A           -------------------LVGKSVEEAKKVIL-QDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNI
1dapA           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
1delB           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
2ak3A           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QGMTNExxxxxxxxxxxxxxxx
3dmdC           FVGVGQ----------------
3b5jA           QG--------------------
3dmdB           FVGVGQ----------------
3cmvG           INFYGE----------------
3cmvH           INFYGE----------------
2bifA           ----------------------
2dwoA           CD--------------------
3c95A           ----------------------
2c03B           FAGVSE----------------
2ccgB           NVVED-----------------
2ccjB           NV--------------------
2d3wB           SGDFTL----------------
2ccgA           VN--------------------
1bifA           DRDLSY----------------
3cmvC           YGELVD----------------
2dwpA           DK--------------------
1e9cA           AVHEDI----------------
3b60A           RGTHSE----------------
2czvA           ----------------------
2a2zD           ----------------------
2b8tA           NSNSEE----------------
1e9fA           EK--------------------
3cmvA           EGENVV----------------
2c61B           KAVSDQ----------------
4dcgA           TVYCNK----------------
1e2dA           AVHEDI----------------
2a30D           ----------------------
1e9dA           AVHEDI----------------
1e69A           ----------------------
1d1cA           GAGEGA----------------
2cjwB           ----------------------
3eiuB           KAVSDQ----------------
3eiuA           HKAVSD----------------
3dm5A           FIGTGE----------------
2cgtH           FGDRRK----------------
2a5gA           ----------------------
2cckA           ----------------------
2a2zA           ----------------------
3cmxA           LGVKEK----------------
2akaB           RRGYIG----------------
1e98A           AVHEEI----------------
2bbsA           YGTFSE----------------
3a1wA           ----------------------
3cmvE           INFYGE----------------
2bc9A           FFP-------------------
2axpA           ----------------------
2a30B           ----------------------
3czpB           ----------------------
2c03A           AG--------------------
1bg0A           SHDDRF----------------
2c9yA           RGIHSA----------------
1e9rA           NGG-------------------
1aroP           AI--------------------
1e9sG           VTM-------------------
3b85A           ----------------------
2ctsA           ----------------------
1e9sJ           VTMPDG----------------
2dr3A           ELKRSL----------------
2b8wA           EE--------------------
2awnC           VGKPLE----------------
2a2zB           ----------------------
3adkA           ----------------------
2a5jA           ----------------------
1e9sF           VTM-------------------
3b2qA           VVA-------------------
2c04A           AG--------------------
2dr3E           EL--------------------
1e4yA           VRKRLV----------------
1e9sD           VTMPDG----------------
1e9sB           ----------------------
1e2kA           ----------------------
3cmtD           LGVKEK----------------
2awnD           SDIADV----------------
421pA           ----------------------
2a30A           ----------------------
2b8tB           NSNSEE----------------
2bdtA           ----------------------
3d3kA           ----------------------
1dekB           YY--------------------
1cr4A           VRILKC----------------
1e2fA           ----------------------
3b2qB           KAVSDQ----------------
3cddC           TVGGIK----------------
2akaA           GAGEGA----------------
1cfrA           ALYTH-----------------
3cr7C           ----------------------
3d7wA           ----------------------
1e3mA           HG--------------------
3dt2A           HDPFAM----------------
1dekA           ----------------------
2axzC           INIFKI----------------
1e0jA           GSGALR----------------
1dhjA           GDTHFP----------------
3d3qA           VQHLVE----------------
3dt4A           HDPFAM----------------
3clvA           ----------------------
3cddF           ELIASI----------------
1dhiA           GD--------------------
3czpA           ----------------------
1e0jB           GSGALR----------------
2d0kA           GDTHFP----------------
1e3mB           HGDTIA----------------
3cm0A           ----------------------
1e3aB           SV--------------------
2awnB           VGKPLE----------------
2bjbA           TG--------------------
3cddD           ----------------------
3cr7A           ----------------------
2bhjA           YA--------------------
1e9sM           ----------------------
2c0bL           RLREAV----------------
3be4A           ----------------------
2cckB           ----------------------
2d62A           VGTPDE----------------
3c8uA           ARLPAD----------------
3cmwC           VG--------------------
2dr3B           DLDEID----------------
3bb1A           PHLVQT----------------
1e59A           LNIPTG----------------
1e2gA           AV--------------------
2b8tC           ----------------------
1ai4B           SVGAKI----------------
3d3qB           VQHLVE----------------
3da4A           ----------------------
1dkiA           NF--------------------
4atjA           DPTLNT----------------
2bkiA           DEEKLD----------------
1e2hB           ----------------------
2c9oC           ----------------------
1e6cA           ----------------------
2ahwD           ----------------------
3dlbB           IPKLMG----------------
3bk7A           HG--------------------
2d4uA           ----------------------
3dm9B           FVGVGQ----------------
2b92B           DEELDP----------------
2c4rL           VR--------------------
2drcA           GDTHFP----------------
1d6jB           ----------------------
2boeX           AG--------------------
3crmA           ----------------------
2bkhA           LDLFRV----------------
3czjA           TPH-------------------
2c7cH           FGDRRK----------------
2d4hB           VLTYVN----------------
3dtbB           DPFAMR----------------
1e9rF           NGGNLF----------------
3cmuA           ----------------------
2bofX           ----------------------
1cjtC           ----------------------
3ch4B           ----------------------
3cr7D           ----------------------
3dauA           GDTHFP----------------
2ahvA           ATLHPK----------------
3dt4C           ----------------------
1dg3A           VADFCS----------------
1cr1A           ----------------------
1bglA           TPH-------------------
2d4uB           ----------------------
2cvfA           ----------------------
2bx2L           IDFIDM----------------
1e9sH           NGGN------------------
1cs4C           ----------------------
2awoC           VGKPLE----------------
1accA           DGKTFI----------------
2c61A           RELHRK----------------
3dhwC           QDTVSE----------------
1draA           GDTHFP----------------
2a1fF           MGMLAT----------------
3dfnC           DDGR------------------
1e9rE           VTMPDG----------------
1cr2A           ----------------------
2bwjA           ----------------------
3d31A           VGKPEE----------------
1dyhA           GD--------------------
3bo6B           ----------------------
2b8wB           FDRPVH----------------
1aldA           DDGR------------------
3dfqA           DDGR------------------
3bb1B           ----------------------
4dfrA           GD--------------------
3cr7B           ----------------------
3cioD           ----------------------
2d4hA           DEELDP----------------
3dfoD           DDGR------------------
3dfpD           DDGR------------------
3bgwA           QL--------------------
3dftD           DDGR------------------
3dt7A           HDPFAM----------------
1ek0A           ----------------------
3dfnA           DDGR------------------
3bczC           QLD-------------------
3bgwD           QL--------------------
1drbA           GDTHFP----------------
1dvrA           TG--------------------
1e9sL           ----------------------
3dftC           DDGR------------------
1culC           ----------------------
3dfqD           DDGR------------------
1afrA           KKISMP----------------
3dfpC           DDGR------------------
3cbnA           ----------------------
1eilA           FGLPLE----------------
2czvB           ----------------------
1ak2A           ----------------------
1e9rD           VTMPDG----------------
3dffA           HEKNVP----------------
2eg5G           LDSFNL----------------
3a00A           ----------------------
6aldA           DDGR------------------
3bh0A           QL--------------------
1e2iA           ----------------------
2ck3C           LPVIET----------------
3dfnD           DDGR------------------
2dr3F           EL--------------------
1akeA           EVRADL----------------
2ausC           IQRTRK----------------
1dp0A           TPHP------------------
3dfqC           DDGRPF----------------
3bjdB           KGSHPR----------------
3a00B           ----------------------
3c15C           ----------------------
3dymA           TPHP------------------
1e9rG           ----------------------
2dr3C           ELKRSL----------------
1av6A           QEYDYF----------------
2awoA           VGKPLE----------------
1adoA           DDGR------------------
2bhvA           ----------------------
3c14C           ----------------------
3ecpA           RPDDPA----------------
3bpbA           AGYPRT----------------
1c9kC           ----------------------
1e9sE           ----------------------
1dw9A           ----------------------
5dfrA           GDTHFP----------------
1d6jA           ----------------------
2ccjA           NV--------------------
1e2mB           WGQ-------------------
3b55A           SQHLTP----------------
3dfoC           DDGRPF----------------
3ec1A           NDPGAQ----------------
2dftA           ----------------------
1e2mA           ----------------------
2dflA           RI--------------------
3bb1E           PHLVQT----------------
2anbA           QKQRHD----------------
3bwdD           ----------------------
2bbsB           YGTFSE----------------
1cr0A           VRILKC----------------
1cjuC           ----------------------
1e4vA           EV--------------------
2ancF           ----------------------
3cnlA           ----------------------
1e9sI           VTM-------------------
2dr3D           DLDEID----------------
1eamA           VVVNFD----------------
2ancD           QKQRHD----------------
2dftC           ----------------------
2aumA           ----------------------
3dyoA           TPHPAR----------------
1e2iB           ----------------------
3ed8A           ----------------------
3bm2B           GFL-------------------
2aunB           ----------------------
3bb1H           NDSDEK----------------
1bmfC           LPVIET----------------
2awnA           VGKPLE----------------
2aunA           GLGLQE----------------
2aumB           GLGLEQ----------------
3e8aC           ----------------------
2c95B           ----------------------
2d2eA           TGGPEL----------------
1e2kB           A---------------------
3bv4A           DDGR------------------
2cdnA           ----------------------
3bb1F           PHLVQT----------------
1e2jA           ED--------------------
3b85B           ----------------------
1e2nA           ----------------------
3di4A           DWPSPS----------------
2a1fD           MGMLAT----------------
3c7kC           ERKKWI----------------
3d1mA           ITTSDR----------------
1cjaA           ----------------------
3cmvB           YG--------------------
1e9rB           ----------------------
2bv7A           ----------------------
2bhvD           ISPNTD----------------
1e2nB           SGPQ------------------
2a5vA           ----------------------
3dvlD           RN--------------------
1e9sA           ----------------------
2a5vB           ----------------------
3cueF           ----------------------
1b0uA           EGDPEQ----------------
1azsC           ----------------------
2a1fC           MGMLAT----------------
3brwA           DI--------------------
1bccF           ----------------------
2ancB           QKQRHD----------------
3cnnA           ----------------------
3d1mB           ITTSDR----------------
2dpyB           ----------------------
3cphA           ----------------------
1ckvA           ----------------------
1e2jB           ----------------------
2c5mD           LGGT------------------
3c7kA           ----------------------
3bjqB           IVPSAL----------------
3dfdA           ----------------------
2dpyA           ----------------------
3dkvA           ----------------------
1e1qB           KG--------------------
2e85B           IVGFYY----------------
1e2lA           ----------------------
2bbtB           YGTFSE----------------
2bkeA           RVVDAP----------------
1e2lB           ----------------------
2e85A           IVGFYY----------------
3bs4A           ----------------------
3bb1C           PHLVQT----------------
1d8jA           ----------------------
2b8tD           SNSEEF----------------
2a1fE           MGMLAT----------------
2aexA           KAGVSI----------------
2bwjB           ----------------------
2d3wD           SGDFTL----------------
3cr8B           ----------------------
1e9sK           VTMPDG----------------
2d3wC           SGDFTL----------------
2d7vA           ----------------------
2an9A           QKQRHD----------------
1e2hA           EDW-------------------
3bb1G           PHLVQT----------------
3dm5B           FIGTGE----------------
1d6aA           ----------------------
1cjvC           ----------------------
3cbqA           ----------------------
2d7vB           ----------------------
3cd9A           ----------------------
2bhvC           ----------------------
1ckeA           ----------------------
2a78A           ----------------------
3do6A           ----------------------
2b0lC           KGTYIK----------------
2bwjD           ----------------------
1d2zD           ----------------------
3b9qA           FIGVGE----------------
2awoD           SDIADV----------------
3cddA           ----------------------
3cqcA           ----------------------
3c85A           ----------------------
1delA           ----------------------
3bb1D           ----------------------
1chdA           AEDGER----------------
2c9gA           ----------------------
3cddE           ----------------------
2bwjF           ----------------------
1agpA           ----------------------
2atjA           ----------------------
1e6vC           ----------------------
2c9oA           ELVPGV----------------
2ax4B           ----------------------
2ax4A           ----------------------
2bwjC           ----------------------
3bb4A           ----------------------
3dsrB           ----------------------
2dwqB           ----------------------
3cddB           ----------------------
2bwjE           ----------------------
2cxxA           ----------------------
3ci2A           AQ--------------------
1dapA           ----------------------
2c9oB           ----------------------
1egaA           ----------------------
2atxA           ----------------------
1delB           ----------------------
2a5fA           ----------------------
3cwzA           ----------------------
2e9sA           ----------------------
3bfkB           ----------------------
3a1vA           ----------------------
2ak3A           ----------------------
1an0A           ----------------------
1byuB           ----------------------
2cxxB           ----------------------