[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ecol0:AAC73143.1

[Show Plain Result]


## Summary of Sequence Search
    1::382
    3::131     5e-42  61%  131 aa  PF00988 CPSase_sm_chain "Carbamoyl-phosphate synthase small chain,
    5::182     4e-28  40%  185 aa  PF00117 GATase "Glutamine amidotransferase class-I"
   14::214     1e-04  32%  214 aa  PF07722 Peptidase_C26 "Peptidase C26"
    1::382

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
PF00988         ----AYLVLEDGTVFRGKSFGAEGSVVGEVVFNTGMTGYQEILTDPSYAGQILVLTYPLIGNYGVNDEDF
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIxxxxxxx
PF00988         ESSRIHVAGLVVRELSETPSHWRATKSLSDWLKEHGVPGISGIDTRALTKKLREKGSMLGRIV-------
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPFHVVAYDFGAKRNILRMLV
PF00988         ----------------------------------------------------------------------
PF00117         -------------------------------------------------------AYD-SFTENLARALR
PF07722         --------------------------------------------------PFHGVGESYLAASYVDAVEA


                         .         .         .         +         .         .         .:280
query           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
PF00988         ----------------------------------------------------------------------
PF00117         ELGAEVEVVPNDSDALEILLLNPDGILVSGGPGSPGDIEGKIEAIKYARENGVPVLGICLGMQLLAEAFG
PF07722         AGGLPLPIVGDEEDLEELLEL-LDGLLLTGGADDPERDAFELALIRAALERGIPVLGICRGMQLLNVALG


                         .         *         .         .         .         .         +:350
query           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
PF00988         ----------------------------------------------------------------------
PF00117         GKVVKAKVPHHGGNHDGSPLFYGLPEVFYVRHRHSYEVNPLPEGLEVLATSEDGGTIMAIVHKDNPFFGV
PF07722         GTLYQLDHREHPQDGPSHEVRAEEIMVNSLHHQAI---KRLGPGLRV-EATAPDGLIEAIESPDAPYFGV


                         .         .         .         .         *         .         .:420
query           QGHPEASPGPHDAAPLFDHFxxxxxxxxxxxx
PF00988         --------------------------------
PF00117         QFHPESSSTPGGLHLLFNFF------------
PF07722         QWHPE---------------------------