[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ecol0:AAC73177.1

[Show Plain Result]


## Summary of Sequence Search
    1::232
    1::123     2e-23  47%  123 aa  PF00005 ABC_tran "ABC transporter"
   30::73      1e-04  41%  278 aa  PF05049 IIGP "Interferon-inducible GTPase (IIGP)"
    1::232

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxVAILGPSGAGKSTLLNLIAGFLTPASGSLTIDGVDHTTMPPSR
PF00005         --------------------------------------STLLRLLAGLLKPTSGKILLDGVI-SPLELRK
PF05049         ---------------------------IAVTGESGSGKSSFINALRGLGHEEEGA-APTGVVETTMEPTR


                         .         .         *         .         .         .         .:140
query           RPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQGKMHAIARQMGIDNLMARLPGELSGGQRQRVAL
PF00005         LRIGYVFQDPALFPHLTVRENIAFGLKNDEKLKEIKKKELEALER-VGLLKFLYRYPHELSGGQRQRVAI
PF05049         YP--------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ARCLVREQPILLLDEPFSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ARALIKEPKVLLLDEPTS----------------------------------------------------
PF05049         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxx
PF00005         ----------------------
PF05049         ----------------------