[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ecol0:AAC74699.1

[Show Plain Result]


## Summary of Sequence Search
    1::193
    3::186     1e-38  57%  187 aa  PF02508 Rnf-Nqr "Rnf-Nqr subunit, membrane protein"
    1::193

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxDYLLLFVGTXXXXXXXXXXXXXXCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
PF02508         --EYLSLFVSGIFVNNPVLVQFLGLCPFLAVSKKVETALGMGLAVTFVLTLSNPLISLLRNFILS-----


                         .         .         *         .         .         .         .:140
query           YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
PF02508         YLRIIVFILVIAALVQLVEMVLKAYSPSLYKALGIFLPLITTNCAVLGRALAFASKDNPFLESLLDGLGA


                         +         .         .         .         .         *         .:210
query           AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVxx
PF02508         GLGFTLALVLLAGIRERLGYGDVPGPLRGLPIALITAGLMALAFMGFGGLI--