[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ecol0:AAC75368.1

[Show Plain Result]


## Summary of Sequence Search
    1::228
   30::121     2e-05  37%  195 aa  PF00528 BPD_transp_1 "Binding-protein-dependent transport system
    1::228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRGVPDLVLMLLIFY
PF00528         --------------------------------------------------------RAIPSLVLLLLLLF


                         .         .         *         .         .         .         .:140
query           GLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTRGQVFRR
PF00528         AIGLGGGWILGLLGLGH----GLLAVILALVLSTAPFVRLIRRAALESIPKDLIEAARALGASRWQTFRR


                         +         .         .         .         .         *         .:210
query           IMFPSMMRYALPGIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         VILP----LALPGI--------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxx
PF00528         ------------------