[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for ecol0:AAC77012.1

[Show Plain Result]


## Summary of Sequence Search
    1::122
    2::85      2e-16  51%  104 aa  PF01219 DAGK_prokar "Prokaryotic diacylglycerol kinase"
    1::122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVE
PF01219         ---------------GYALKGLKAALRTERAFRQHLFLALIVIALGFFLGLSLIEWVLLILTILLVLIVE


                         .         .         *         .         .         .         .:140
query           ILNSAIEAVVDRIGSEYHELSGRAKDMGSxxxxxxxxxxxxxxxxxxxxxxx
PF01219         LLNTAIEAVVDLISPEYHPLAKRAKDMAA-----------------------