[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ecol0:AAC73143.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a9xB2.bssp"
#ERROR : Can't open dsspfile "1a9xB1.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "1gpmA2.bssp"
#ERROR : Can't open dsspfile "1o1yA.bssp"
#ERROR : Can't open dsspfile "1i1qB.bssp"
#ERROR : Can't open dsspfile "1fy2A.bssp"
#ERROR : Can't open dsspfile "1wl8A1.bssp"
#ERROR : Can't open dsspfile "1l9xA.bssp"
#ERROR : Can't open dsspfile "2ghrA1.bssp"
#ERROR : Can't open dsspfile "1gpwB.bssp"
#ERROR : Can't open dsspfile "1q7rA.bssp"
#ERROR : Can't open dsspfile "1t3tA2.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "1u5hA.bssp"
#ERROR : Can't open dsspfile "1j42A.bssp"
#ERROR : Can't open dsspfile "1ka9H.bssp"
#ERROR : Can't open dsspfile "1sy7A1.bssp"
#ERROR : Can't open dsspfile "1jvnA2.bssp"
#ERROR : Can't open dsspfile "1dizA2.bssp"
#ERROR : Can't open dsspfile "1s1mA1.bssp"
#ERROR : Can't open dsspfile "1suwA.bssp"
#ERROR : Can't open dsspfile "1g2iA.bssp"
#ERROR : Can't open dsspfile "1n2zA.bssp"

## Summary of PDB Search
:382
    e-104  99%  1a9xB2 [c.23.16.1] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
    6e-77 100%  1a9xB1 [c.8.3.1] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
    2e-36  25%  1qdlB  [c.23.16.1] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    5e-34  21%  1gpmA2 [c.23.16.1] GMP SYNTHETASE A:3 -- 207
    5e-34  19%  1o1yA  [c.23.16.1] CONSERVED HYPOTHETICAL PROTEIN TM1158
    4e-33  21%  1i1qB  [c.23.16.1] ANTHRANILATE SYNTHASE COMPONENT II
    2e-32  12%  1fy2A  [c.23.16.4] ASPARTYL DIPEPTIDASE
    2e-32  23%  1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    7e-31  19%  1l9xA  [c.23.16.1] GAMMA-GLUTAMYL HYDROLASE
    9e-31  11%  2ghrA1 [c.23.16.8] HOMOSERINE O-SUCCINYLTRANSFERASE A:17 -- 297
    2e-30  20%  1gpwB  [c.23.16.1] AMIDOTRANSFERASE HISH
    5e-30  18%  1q7rA  [c.23.16.1] PREDICTED AMIDOTRANSFERASE
    2e-28  10%  1t3tA2 [c.23.16.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE
    2e-27  20%  1aa7A  [a.95.1.1] INFLUENZA VIRUS MATRIX PROTEIN
    4e-23  15%  1u5hA  [c.1.12.5] CITE
    6e-23  15%  1j42A  [c.23.16.2] RNA-BINDING PROTEIN REGULATORY SUBUNIT
    1e-22  18%  1ka9H  [c.23.16.1] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    2e-22  17%  1sy7A1 [c.23.16.3] CATALASE 1 A:553 -- 736
    1e-18  20%  1jvnA2 [c.23.16.1] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN A:-3
    2e-17   8%  1dizA2 [d.129.1.2] 3-METHYLADENINE DNA GLYCOSYLASE II A:1 -- 99
    3e-17  30%  1s1mA1 [c.23.16.1] CTP SYNTHASE A:287 -- 544
    3e-08  18%  1suwA  [e.52.1.1] PROBABLE INORGANIC POLYPHOSPHATE/ATP-NAD KINASE
    8e-05  21%  1g2iA  [c.23.16.2] PROTEASE I
    6e-04  35%  1n2zA  [c.92.2.2] VITAMIN B12 TRANSPORT PROTEIN BTUF
:382

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1a9xB2          ----------------------------------------------------------------------
1a9xB1          -IKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
1qdlB           ----------------------------------------------------------------------
1gpmA2          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1fy2A           ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1u5hA           ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1dizA2          ----------------------------------------------------------------------
1s1mA1          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1g2iA           ----------------------------------------------------------------------
1n2zA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1a9xB2          ----------------------------------------------------------------------
1a9xB1          ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
1qdlB           ----------------------------------------------------------------------
1gpmA2          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1fy2A           ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1u5hA           ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1dizA2          ----------MYTLNWQPPYDWSW---MLGFLAARAVSSVETVADSYYARSLAVGEY-RGVVTAIPDIAR
1s1mA1          ----------------------------------------------------------------------
1suwA           ----------------------------------------------------------------------
1g2iA           ----------------------------------------------------------------------
1n2zA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
1a9xB2          ------------LNGMDLAKEVTTAEAYSWTQGSWTLTGGLPQAKKEDELPFHVVAYDFGAKRNILRMLV
1a9xB1          ALALEKARAFPG----------------------------------------------------------
1qdlB           ----------------------------------------------------LTLIIDNYDVYNIAQIVG
1gpmA2          ----------------------------------------------ENIHKHRILILDFGSQQLVARRVR
1o1yA           --------------------------------------------------HVRVLAIRHVEIEDLEDIFR
1i1qB           ----------------------------------------------------DILLLDNIDTWNLADQLR
1fy2A           -----------------------TLPGKAWLEHALPIANQLNGRRSAVFIPFVTQTWDEYTD-KTAEVLA
1wl8A1          -----------------------------------------------------IVIMDNGGQHRIWRTLR
1l9xA           ----------------------------------------------------VMKNYGYYIAASYVKYLE
2ghrA1          ------------------------------------------RAETQDIRALKIAILNLXPTKQLLRLIG
1gpwB           ----------------------------------------------------GIISVGPGNIMNLYRGVK
1q7rA           -----------------------------------------------------VLGLQ-GAVREHVRAIE
1t3tA2          -----------------------------------------------------LREQGVNSHVEMAAAFH
1aa7A           ---------------MSLLTEVETYVLS-IIPSG--------PLKAEIAQRLEDVFAGKNTDLEVLMEWL
1u5hA           ---------------------------------------------------VRINAGGTADQARDLEALA
1j42A           ---------------------------------------------------MRRAGIKVTVAGLAGKDPV
1ka9H           -----------------------------------------------------LIDYGSGNLRSAAKALE
1sy7A1          ---------------------------------------------------------VIGPRRSKVT---
1jvnA2          -----------------------------------------------------VIDVESGNLQSLTNAIE
1dizA2          HTLHINLSAGLEPVAAECLAKMSR----------------------------------------------
1s1mA1          ----------------------------------------------------------------------
1suwA           -----------------------------------------------------VVYKTDGHVKRIEEALK
1g2iA           ----------------------------------------------------------------------
1n2zA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
1a9xB2          DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGIXLGHQLLALASG
1a9xB1          ----------------------------------------------------------------------
1qdlB           ELGSYPIVIRNEISIKGIERIDPDRLIISPGPGTPEKREDISLDVIKYLGKRTPILGVCLGHQAIGYAFG
1gpmA2          ELGVYCELWAWDVTEAQIRDFNPSGIILSGGPEST-TEENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLG
1o1yA           EKNWSFDYLDTPKGEKLERPLEEYSLVVEKYPFLK----YEFQLIEEILKKEIPFLGIXLGSQXLAKVLG
1i1qB           TNGHNVVIYRNHILIDRLATMKNPVLMLSPGPGVPSEAG-CMPELLTRLRGKLPIIGICLGHQAIVEAYG
1fy2A           PLGVNVTGIHRVADPLAAIE-KAEIIIVGGGNTFQLLKESRERPMADRVKRGALYIGWSAGANLACPTIR
1wl8A1          YLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGN-CEKVLEHYDEFNVPILGICLGHQLIAKFFG
1l9xA           SAGARVVPVRLDLTEKDYEILSINGILFPGGSVDLRRSDYALSIQSFDDGDYFPVWGTCLGFEELSLLIS
2ghrA1          NTPLQLDVHLFYKTFRDIENEKFDGLIITGAPVETLSFEEVKRIXEYSKTNVTSTLHICWGAQAGLYHHY
1gpwB           RASENFEDVSIELVESPRN-DLYDLLFIP-GVGHFGEGMRRIDFVRKHVEDERYVVGVCLGMQLLFEESE
1q7rA           ACGAEAVIVKKSEQLEGL-----DGLVLPGGESTTXRRLIDRYPLKQFAAAGKPXFGTCAGLILLAKRIV
1t3tA2          RAGFDAIDVHMSDLGGRIGLGNFHALVACGGFSYGDVLGAGEGWAKSILRPQTLALGVXNGCQMMSNLRE
1aa7A           KTRPILSPLTFTLTVPSERGLQRRRFVQNNGNGDPNNMDKALYRKLKREITFHGAKEISLSYSAGALASC
1u5hA           GTAYTTVMLPKAESAAQVIELAPRDVIALVETARG------AVCAAEIAAA-DPTVGMMWGAEDLIATLG
1j42A           QCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSAVKEILKEQENRKGLIAAICAGPTALLAHEI
1ka9H           AAGFSVAVAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSE
1sy7A1          --AANGSTVQPHHHLEGFRSTMVDAIFIPGGAKAAETLSRALHWIREAFGHLKAIGATGEAVDLVAKAIA
1jvnA2          HLGYEVQLV---KSPKDFNISGTSRLILP-GVGNYGHFVDNLFNIREYIESGKPIMGIXVGLQALFAGSV
1dizA2          ----------------------------------------------------------------------
1s1mA1          -----------------------DAILVPGGFGYRGV-EGMITTARFARENNIPYLGICLGMQVALIDYA
1suwA           RLEVEVELFN---QPSEELE-NFDFIVSVGGDGT------ILRILQKL-KRCPPIFGINTGRVGLLTHAS
1g2iA           --------VKVDLTFDKVNPEEFDALVLPRAPERVRLNEKAVSIARKXFSEGKPVASICHGPQILISAGV
1n2zA           ----------PQVSREQVLARSPQAIVITGGPDQIP----------------------------------


                         .         *         .         .         .         .         +:350
query           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1a9xB2          AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
1a9xB1          ----------------------------------------------------------------------
1qdlB           AKIRRARKVFHGKISNIILVNIAKEFKATRYHSLVVDE--VHRPLIVDAISAEDNEIMAIHHEEYPIYGV
1gpmA2          GHVEASNEREFGYAQV--EVVNDSALVRGIEDALTADKVTAIPSDFITVASTESCPFAIMANEEKRFYGV
1o1yA           ASVYRGKNGEEIGWYFVEKVSDNKFFREFPDRLRVFDTFDLPRRATRVFTS-EKYENQGFV--YGKAVGL
1i1qB           GYVGQILHGKATSIEQAMFAGLANPLPVARYHSSNVPAGLTINA-------HFNGMVMAVRHDADRVCGF
1fy2A           TT--NDMPIVDPNGFDALDLFPLQINPHFTNTREQRIRELLVVAPELTVIGLPEGNAVLGGPNTTWVFKA
1wl8A1          GKVGRGEKAEYSLEIIDEEIFKGLPKRLKVWESHMDEVKELPPKFKI-LARSETXPIEAMKHEELPIYGV
1l9xA           GECLLTATDTVDVAMPLNFTGGQLHPLTANFHKWSLSVKNFTMNEKNVLTTNTDGKIETMEGYKYPVYGV
2ghrA1          GVQKYPLKEKXFGVFEHQGFDELFFAPHSRHTEVRESDIREVKELTLLANSE-EAGVHLVIGQEGRQVFA
1gpwB           EAPGVKGLSLIEGNHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGF
1q7rA           GYDEPHERNSFGRQRESFEAELSIKGVGDGFVGVFIRAPHAGDGVDVLATY--NDRIVAAR--QGQFLGC
1t3tA2          LIPGSELWPRFVRNHSDRFEARFSVEVRDDAHLAALDNFGKVTETYPANPNGSPNGITAVTTENGRVTIM
1aa7A           MGLIYNRMGAVTTE-----VAFGLVCATCEQ---------------------------------------
1u5hA           ---GSSSRRADGAYRDVARHVRSTILLAASAFGRLALDHLDILDVEGLQEEARDAAAVGF------DVTV
1j42A           GCLAKDKMMNGGHYTYSENVEKDGLILTSRGPGTSFEFA-------------------------------
1ka9H           EAPGVRGLGLVPGEVRRFRAGRVPQMPLTGRHFYFANSYYGPLTPYSLGKGEYEGTPFTALLAKENLLAP
1sy7A1          LPQVTVSSEAEVLKKVKPESFTDAVKIAKGAAGFLGEFFYAIAQHRNWDRE-LDGLHSMI----------
1jvnA2          ESPKSTGLNYDDSEKPVPEIGWNSCIPSENLHSFAAILNNLENDGWKIAKAKYGSEEFIAAVNKNNIFAT
1dizA2          ----------------------------------------------------------------------
1s1mA1          RHVANMENANSTEKYPVRDENGNVTIVERHRHRYEVNNMLLKAGLRVAGRSGDDQLVEIIEVPNHPWFAC
1suwA           PENFEVELKKAVEKFEVERFPRVSCSAMPDVLAL------------------------------------
1g2iA           LRGRKGGIKDDXINAGVEWVDAEVVWVSSRVPADLYA---------------------------------
1n2zA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           QGHPEASPGPHDAAPLFDHFIELIEQYRKTxx
1a9xB2          QGNPEASPGPHDAAPLFDHFIELIEQYRKT--
1a9xB1          --------------------------------
1qdlB           QFHPESVGTSLG-YKILYNFLNRV--------
1gpmA2          QFHPEVTHTRQG-MRMLERFVRDICQCE----
1o1yA           QFHIEVG--ARTXKRWIEAYKDELEKKKID--
1i1qB           QFHPESILTTQG-ARLLEQTLAWAQQ------
1fy2A           GEEAVALEAGHR--------------------
1wl8A1          QFHPEVAHTEKG-EEILRNFAKLCGE------
1l9xA           QWHPEKAPYEWKNLDGISHAPNAVK-------
2ghrA1          LGHSE-----YSCDTLKQEYERDRDKG-----
1gpwB           QFHPEKS--SKIGRKLLEKVIECS--------
1q7rA           SFHPELTDDHR----LXQYFLNXVKEAK----
1t3tA2          MPHPERVFRTVANSWHPENWGE----------
1aa7A           --------------------------------
1u5hA           CIHPSQIPVVRKAY------------------
1j42A           --------------------------------
1ka9H           QFHPEKSAGLA----FLALARRYF--------
1sy7A1          --------------------------------
1jvnA2          QFHPEKS---GKALNVIENFLKQQ--------
1dizA2          --------------------------------
1s1mA1          QFHPEFTSTPRDGHPLFAGFVKAASEFQK---
1suwA           --------------------------------
1g2iA           --------------------------------
1n2zA           --------------------------------