[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ecol0:AAC73177.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1f6bA.bssp"
#ERROR : Can't open dsspfile "1oy5A.bssp"
#ERROR : Can't open dsspfile "1rz3A.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1xzpA2.bssp"
#ERROR : Can't open dsspfile "1zd9A1.bssp"

## Summary of PDB Search
:232
    5e-39  23%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    2e-38  30%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    2e-33  29%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-31   9%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    5e-31  16%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    3e-30  14%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    7e-30  27%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    2e-29  11%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-29  10%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    7e-29  22%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-28  14%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    7e-28   8%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    1e-26  16%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    2e-26  12%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    4e-26  12%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    8e-26  16%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    1e-25   9%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    6e-25  29%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    4e-24  12%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    4e-24  12%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    1e-23  11%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    7e-23  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    1e-22  10%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    2e-22   9%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    4e-22  19%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    5e-22  12%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    1e-21  13%  1rkbA  [c.37.1.1] PROTEIN AD-004
    1e-21  12%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    3e-21  16%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    7e-21   8%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    7e-21  11%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    1e-20   9%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    2e-20  12%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    3e-20  12%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    4e-20  10%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    4e-20   9%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    5e-20  12%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    1e-19  12%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    2e-19   8%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    4e-19  13%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    4e-19  10%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    7e-19  11%  1jb1A  [c.91.1.2] HPRK PROTEIN
    9e-19  14%  1t3wA  [a.236.1.1] DNA PRIMASE
    1e-18  10%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    2e-18  10%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    4e-18  10%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    1e-17  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    1e-17  15%  1g6oA  [c.37.1.11] CAG-ALPHA
    2e-17  12%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    3e-17   6%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    4e-17  14%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    5e-17   9%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    6e-17  14%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    9e-17  17%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    1e-16  20%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-16  14%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-16  10%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    3e-16  11%  1jbkA  [c.37.1.20] CLPB PROTEIN
    4e-16  13%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    7e-16   8%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    7e-16  10%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    1e-15  14%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    1e-15  11%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    1e-15  17%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    3e-15  13%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    5e-15  18%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    6e-15  14%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-15   5%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    9e-15   7%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    1e-14  16%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    2e-14   6%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    2e-14  12%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    3e-14  10%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    3e-14  11%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    4e-14  14%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    6e-14  15%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    7e-14  20%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    7e-14  11%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    4e-13  16%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    5e-13  12%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    6e-13  12%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    6e-13  10%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    8e-13   7%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    1e-12  11%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    1e-12  12%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    1e-12  13%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    2e-12  12%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    3e-12  17%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    3e-12  12%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    3e-12  18%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    4e-12   7%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    7e-12  10%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    1e-11   6%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    1e-11  17%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-11  11%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    1e-11  10%  1sbxA  [a.6.1.4] SKI ONCOGENE
    3e-11   8%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    5e-11  12%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    1e-10  14%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    1e-10  19%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    2e-10  16%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    2e-10  23%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-10  14%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    3e-10  12%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    3e-10  13%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-10  27%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-10  16%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    8e-10  11%  1mi8A  [b.86.1.2] DNAB INTEIN
    8e-10  18%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    1e-09  25%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    1e-09  11%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    2e-09  12%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    2e-09   9%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    3e-09  12%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    3e-09  13%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    7e-09   8%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    3e-08   8%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    3e-08  15%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    6e-08  12%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    8e-08  16%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    1e-07  14%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-07  12%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    2e-07   6%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    3e-07  15%  1oa8A  [b.145.1.1] ATAXIN-1
    7e-07  25%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    1e-06  11%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    2e-06  15%  1g31A  [b.35.1.1] GP31
    3e-06  13%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    9e-06  15%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    2e-05   8%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    2e-05  38%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    3e-05  37%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
    3e-05  11%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    4e-05   9%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
    6e-05   9%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    9e-05  40%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 --
    1e-04  32%  1f6bA  [c.37.1.8] SAR1
    1e-04  26%  1oy5A  [c.116.1.4] TRNA (GUANINE-N(1)-)-METHYLTRANSFERASE
    3e-04  32%  1rz3A  [c.37.1.6] HYPOTHETICAL PROTEIN RBSTP0775
    5e-04  44%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    9e-04  56%  1xzpA2 [c.37.1.8] PROBABLE TRNA MODIFICATION GTPASE TRME A:212 --
    0.001  31%  1zd9A1 [c.37.1.8] ADP-RIBOSYLATION FACTOR-LIKE 10B A:18 -- 181
:232

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGSLTIDGVDHTTMPPSR
1sgwA           KLEIRDLSVGYDKPVLEITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKV---K
1b0uA           KLHVIDLHKRYGGHEVGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKD
1l7vC           -----------------LSGEVRAGEILHLVGPNGAGKSTLLARXAG-XTSGKGSIQFAGQPLEAWSATK
1t06A           ---------------MQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQELAEELYATGN
1e69A           ------------------SLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGSAY
1m3eA1          ------------------VKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNSKQIK
1ji0A           VLEVQSLHVYYGAIHAGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHV
1ex6A           -------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVN
1e9rA           -----------------VPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFG
1q3hA           LEKVSFSHLCLNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSW
1nijA1          -----------------------PIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGSVDDQLIG
1n25A           ---LPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRGVAIDQFL
1mukA           ----------------------------WRMCEAREPSVDLLPLCAG-IDPLNSDPFLKMVSVGPMLQSR
1jalA1          ------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRLDA
1pv4A3          ------------------ASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDERPEEV
1ohcA1          --------------------------------------------------DPQDDVYLDITDRLCFAILY
1khbA1          -----------------ITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGL
1pf4A1          -VDVKDVTFTYQGKEKPVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKLTN
1jjvA           ------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDSPLL
1s9hA           -----DPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTV-PFYGCVNWTNENFPFNDCVD
2yyeA2          ------------------QSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKARAC
1grqA           -----------------------TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQ
1bgxT2          ------------------------------------------RGMLPLFEPKGRVLLVDGHH--------
2gx8A1          --------VVVFVPVTHAEEVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLEVRIETIASLQRKVIK
1xbtA1          -----------------------RGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRALLL
1qhlA           -GKFRSLTLINWNGFFARTFDLD-ELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVC---Y
1rkbA           ---------------------LMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYD
1urjA           -----------------FKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIAEPFS
1ffhA2          -----------------RLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA---
2v3jA1          -------------VPQAPTSKDKITKRXIVVLAXASLETHKIYVLLN-CDDHQGLLKKDISEARPDITHQ
1poiA           ------------------AKYVHSGDHIALGGFTTDRKPAVFEILRQGITDLTGMLIGNGRV------KA
1kgdA           -----------------------MRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEENGKN
2axpA1          ---------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLF
1zp6A1          -----------------------GGNILLLSGHPGSGKSTIAEALANLPGVPKV--HFHSDDLWGYIKHG
2iqhA1          -----------------SNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVME
1j1zA2          -------------------------------------------------------------------PYS
1ni3A1          ------------------WGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAKVAV
1e6cA           -------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGVVAAE
1zs3A1          ----------------------------------------------------------------------
1f46A           ---------------------------------------IIMNVAAHHGSELNGELLLNS---------I
1bmfA3          -----------------SLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIG
1jb1A           ------------------LVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIAD-DRVDVYQQDEQTIV
1t3wA           -------------------------------------KRTTXRILIGLLVPELATLVPPLENLDENKLP-
1mjgM           GIKLTKIKLDLNFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGPDIDQIPEGSK
2gk3A1          ----------------------------------------------------------------------
1ak2A1          -----------------------KGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSEL
1udwA           ------------------------PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSAKA
1g6oA           -----------------IKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVFKHHK
2f9hA1          ---------------------------------------------------------------ATVTEIG
1afrA           ------------------THSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPAVRDETGAS
1c4oA1          -----------------LVEALRDGERVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAER
1qhdA1          --------DNSSEYIENWNLQNRRQRTSVLADASETMLANVTSVRQ-EYAIPVGPVFPPGMNWTDLITNY
1viaA           -------------------------KNIVFIGFXGSGKSTLARALAKFLDSDFLIEQKFNQKVSEIFEQK
2vgmA3          ----------------------------------------------------------------------
1f2t.1          -----------------------------VTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESAR
1lw7A2          -------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDA
1tmkA           -----------------------RGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGLIN
1jbkA           -----------------QVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGA
1np6A           ------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAG
1tljA           ------------------YHDKEIGYLDPDILG------FLLAFYRNRNDVYTQSSCSGRITIVDAEMPW
1es6A2          ----------------------------------------------------------------------
1e3mA2          ------------------LNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIGPIDR
1l3aA           ----------------------------------------------------VGYSIYKGKAALTVEPRS
1dnpA2          ----------------------------------------------------------------------
1atrA1          ------------------AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
1mm8A           ----------------------------------------------------------------------
1d6jA           ----------ASALTRRTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN
2qgmA1          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2ancF1          -----------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFL
1cd5A           -VSFKHVVTFNMDEYVGLHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIH
1i1qA           VDRYSYVMHLVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRG-------------SYG
1gm5A1          ----------------------------------------------------------------------
1l7lA           ------------------LANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICH
1cr0A           ------------------TLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGK-------KVGLAMLE
1bs2A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1fl9A           -IPDEFSMLRFKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAG
1em8A           ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1g8fA3          ---------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHN----NK
1yr6A1          ---------------------------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELPSI
1mkyA1          ---------------------------VLIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKLVDTCGVF
1bccF           ------------------------------------------------------------------GIRK
1ovmA2          VIDSPDICWVGLNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAAQQRG
1o7d.2          ----------------------------------------------------------------------
1odfA           ------------YIPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHL-----------MEKYGGEKSI
1t9hA2          -------------------------------------------------------------SLEFTDIEE
1ckvA           -----------------ENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTIKANGKIEVDCDS
2gtlM1          -TITAAHRKSFFRATLSYELDEHDHTVSTTQLRGFYNFGKRELLL-APLKGQSEGYGVICDFNLGDDDHV
1ii8.1          ------------------------------------------------------------KDFTEELIEK
1yvuA2          ------------------------------------GKSLILEKLIPVINKIKDVDLVIVFLYDFVKREL
1sbxA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1tueA           -LRYQQIEFITFGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWLEPLTD
1b77A2          ------------------ITEIKAEDLQQLLR-----VSRGLQIDTIAITNKDGKIVINGYNKVEDSGLT
2gujA1          ---------------------------------VKKGSDPYFTLQAVLDDQSSGRVTLYDVNFDSAKIAE
1yj5A2          ------------YLPESSSLLSPNPEVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQ
1vplA           ------------------SFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEV
1vhhA           ----------------------------------------------------------------------
3cddA2          ------------------SGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWVPS
1d8jA           ----------------------------------------------------------------------
1g6hA           ILRTENIVKYFGEFKAGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAE
1iqrA2          ----------------------------------------------------------------------
1mi8A           RVSIKDLLDEKIWAINEQTMKLESAK-VSRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKRLDEL
1q3tA           -----------------------KTIQIAIDGPASSGKSTVAKIIAKDFYLDTGAM-YRAATYMALKNQL
1w1wA           ----------------------------SIIGPNGSGKSNMMDAIS-FVLGVLKDLIYRGPQSAYVTVSY
2vnuD1          RIRTRRAAELLSIDSWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHDVEYR-----------------
1e2hA           -----------------------TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGAS-ETIA
1a4iA2          ----------------------------------------------------------------------
1jqjA3          ------------------RLYVSENQLKITANNPEQEEAEEILTYSG----------AEMEIGFNVSYVL
1iioA           ----------------------------------------------------------------------
2je6I3          -----------------IVIDIMPVKVPRVIGKNKSMYETL--TSKSIFVANNGRIWAFSEEILIEAIRK
1esmA           LSRLLNFYISSNLRRFLGTNGQRIPYIISIAGSVAVGK------------------STTARVLQALLSRW
1ckeA           ------------------------APVITIDGPSGAGKGTLCKAMAEALLLDSGAIYVDVASEDALVPLA
1pgsA2          -------------LKKNIQLTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGA
1p5zB           -----------------------RIKKISIEGNIAAGKSTFVNILKQLCRWCNVQSTNGGNVLQMMYEKP
1g8yA           -HKPINILEAFPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQI------------AGGPDLLEV
1l1oA           -----------------GMLAQFIDKPVCFVGRLEKIHPTGKMFI--LSDGEGKNGTIELMEDEEISGIV
1zbsA1          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ---------------------------VLIEGNIGSGKTTYLNHFEKYKEPVEKWRNVNGVNLELMYKDP
1heiB1          ---------------------PQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVGSPITYSTYG
1g31A           ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
4tmkA           -----------------------RSKYIVIEGLEGAGKTTARNVVVETL---------------------
1tpzA           ---------------------------VAVTGETGSGKSSFINTLRGIGNEEEGA-AKTGVVEVTM----
1jqjA2          ----------------------------------------------------------------------
1xzpA1          ---VTRLERIKEKLTEELKKADAGILLNRGQEIFERGSDSLITNLRQGHLEDAIKSLKEGMPVDSIDLER
1puoA2          ------------------------------------------------------------------FFAV
1lnzA2          ---------------------------VGLVGFPSVGKSTLLSVVSS-----------------------
1f6bA           ---------------LQFLGLYKKTGKLVFLGLDNAGKTTLLH---------------------------
1oy5A           ----------------------------------------------------------------------
1rz3A           ---------------------------LGIDGLSRSGKTTLANQLSQTLREQGISVCV------------
2cxxA1          ---------------------------IIFAGRSNVGKSTLIY---------------------------
1xzpA2          ---------------------------MVIVGKPNVGKSTLLN---------------------------
1zd9A1          ---------------------------LTLVGLQYSGKTTFVN---------------------------


                         .         .         *         .         .         .         .:140
query           RPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQGKMHAIARQMGIDNLMARLPGELSGGQRQRVAL
1sgwA           GKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNE---IMDALESVEVLDLKKKLGELSQGTIRRVQL
1b0uA           TRLTMVFQHFNLWSHMTVLENVAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSI
1l7vC           LALHRAYLSQQQTPPFATPVWHYLTLHQHDK---TRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRL
1t06A           YDAMYFAGIIADPKAMSESDFDRWI------DGAYFYMLSDYVVAVTLSESNIAQDVADSGDELKMSAGW
1e69A           VETGLGVDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLRKPGRRDQKLSLLSGGEKALVGL
1m3eA1          RXISSYVGENAEFERQYLAGELEVELTPQGTLAERGGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSIAI
1ji0A           INRALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQXLAI
1ex6A           G-KDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNA
1e9rA           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPS
1q3hA           IMPGTIKE--------NIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISL
1nijA1          DRATQIKTLTNGCICCSRSNELEDAL---LDLLDNLDKGNIQFDRLV-IECTGMADPGPIIQTFFSHEVL
1n25A           VVFEDVKGTGGESRDLPSGLDNLRDYLDGSVKVNLEKKHLNQIFPPGIVTMNEYSVPKTLQARFVKQIDF
1mukA           KYFAQTLFMAKTVSGLDVNAIDSALLRLRTLGADKKALTAQL--LMVGLQESEAALAGKIMLQDVNTVQL
1jalA1          LAEIVERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPLDDIDTINTELAL
1pv4A3          TEXQRLVKGEVVASTFD--------EPASRHVQVAEXVIEKAKRLVEHKKDVIILLDSITRLARAYNTVV
1ohcA1          SRSNVHYFDNELEYE-NFYADFGP-LNLAMVYR-----YCCKINKKLKSITMLRKIVHFTGSDQRKQANA
1khbA1          RAINPENGFFGVAPGTSVKTNPNAIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDG
1pf4A1          LRRHFALVSQNVHLFNDTIANNIAYAAEGEYTRRQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVAI
1jjvA           SKIVEHFGAQILNRAALRERVF-------------NHDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLF
1s9hA           KMVIWWEEGKMTAKVVESAKAILGGSK----VRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEH
2yyeA2          TDVTGFGLLGHAW-NICKNSNIGARIFFEKVPYYQLSENLVKKKPKGAIENLNFVKNYLKSNLDNWKLIL
1grqA           SAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVG
1bgxT2          ----LAYRTFHALKGLTTSRGEPVQAVYGFKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDF
2gx8A1          AMVTAHPYEEVAYDVYPLDNKGETLGLGK---IGYLQEEMTLGQFAEHVKQSLDVKGARVVGKLDDKVRK
1xbtA1          RDVAQEALGVAVIGIDEGQFFP---------DIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPL
1qhlA           SMLDTINSRHGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMTDYHSLMFDL
1rkbA           EEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLLYERLETRGYNEKKLTDNIQCEI
1urjA           IGEKFTYPLPFFNRFEAVVGPAAVALR-SRNVDAVARAAAHENHEGAALPADITFTAFAGGFEQRLASVM
1ffhA2          ------------AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPL
2v3jA1          CLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIRSEEKLLKVIKNPI
1poiA           YINCYTANSGVTNVSRRFRKWFEAGK---LTMEDYSQDVIYMMWHTLMQGSGLTDEWGISKEVRKTLDKV
1kgdA           YYFVSHDQMMQDISNNEYLEY-----GSHEDAMYGTKLETIRKIHEQGLIA-ILDVEPQALKVLRTAEFA
2axpA1          EHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKSVIKKRLRVRGDEYIEGKDIDILEL
1zp6A1          RIDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALAIVLRTTAAEAIERCLDRG
2iqhA1          LIIKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRNPGNAEDLIFLARSALILRGSVAHKSCL
1j1zA2          MDANLLHISYEGGVLEDPWAEPPKG--------MFRMTQDPEEAPDAPEYEFFEGDPVAVNGERLSPAAL
1ni3A1          PDERFDWLCEAYKPKSRVPAFLTVFDIAGLTKGATGVGLGNAFLSHVRAVDAIYQVVRAFDDAEIIHVEG
1e6cA           GWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPASLQAHQRPTLTGRPIAEE
1zs3A1          --KAEIDHHKPTAGAMLVLSNLFIENIRLTQAGIYAKSPVKCLREIAQREVEYFFKISDLLLDENEIVPS
1f46A           QQAGFIFGDMNIYHRHLSPDGSGPALFSLANKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQLFKLMLQS
1bmfA3          QKRSTVAQLVKRLTDIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLL
1jb1A           GAAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTISLIVHLENWTPDQLIFDVPVPKPVKVGRNLAIII
1t3wA           ----GLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEK-LSXWDDIADKNIAE--QTFTDSLNHXF
1mjgM           LPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLW--HTGQRNINWLRVSKDAVAKGFRFKNYGEILV
2gk3A1          ---KVLFIGESWHIHXIHSKGYDSF--TSSKYEEGAT-WLLECLRKGGVDIDYXPAPESIDELNRYDVIV
1ak2A1          GKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPEMLDDLMEKRKEKLDSVIEFSIPDSLLI
1udwA           LKGQFNFDHPDAFDNELILKTL----------KEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEG
1g6oA           NYTQLFFGGNI-TSADCLKSCLRXRPDRIILGELRSSEAYDFYNVCSGHKGTLTTLHAGSSEEAFIRLAS
2f9hA1          KHAIDDSEKXIILFGETATDTLKQHAVIQSFPEKDQVTLAEGDHLKIGDTNYTITKVGSFANSNLQSIAH
1afrA           PTSWAIWTRAWTAEENRHGDLLNKYLYLS-GRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQER
1c4oA1          ELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRIVVASVSAIYGLGDP
1qhdA1          SPSREDNLQRVFT-VASIRSML------------------------------------------------
1viaA           RENFFREQEQKXADFFSSCEKACIATGGGFVNVSNLEKAGFCIYLKADFEYLKKRPLFYDEIKAKKLYNE
2vgmA3          ----------------------------------------------------LNKDDDKAWYGE-KEVVK
1f2t.1          EAALSKIGELASEIFAEFTEG---------KYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERFRLAM
1lw7A2          MQYSDYPQXALGHQRY-----------------IDYAVRHSHKIAFIDTDFITTQAFCIQYEGKAHPFLD
1tmkA           EYLTDDSFQLSDQAIHLLFSANRWEIVDKIK--KDLLEGKNIVMDRYVYSGVAYSAAKGTNGMDLDWCLQ
1jbkA           LVAGAKYRGEFEERLKGAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEK
1np6A           AAQTIVASQQRWALMTETPDEEEL--------------DLQFLASRMDTSKLDLILVEGFKHEEIAKIVL
1tljA           DRKNSTIIFKNHLRITEQDLEDVLSLIVQGPIIHIYAKNIETGWDILKIAREAGFKHSGILATNQKGVLV
1es6A2          -----------LRPGISFHPKLRPILLPNKNSADLTSPEKIQAIMTSDFKIVPIDPTKNIMGIEVPETLV
1e3mA2          IFTRVGFEXTETANILHNATEYSLVLXDEIRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLP
1l3aA           PEFSPLSGAFKLSREGMVMLQFAPAAQYDWSRKQVFSLSVTEIGSIISLGKDSCEFFHDPNKGRSDEGRV
1dnpA2          ----------WFRQDLRLHDNLALA-----------AACRNSSARVLALYIATPRQWATHNMSPRQAELI
1atrA1          QVAMVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMGKTVTNAVVTVPAYFNDSQRQATKD
1mm8A           ----SVFSSAALGTARLVNVAAQLAKYSGKSITISSEGSKAAQEGAYRFIRNPNSAEAIRKAGAMQTVKL
1d6jA           KDLGFSEADRNENIRRIAE-------VAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPF
2qgmA1          -----------------------------------------SVQKNISIQSQANPLKTIEPSKPFEDLKP
2pa7A1          --------SRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFHAH--------KKLEQVLVCLNGSCRV
2ancF1          DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMDFDTALTDLKTIIR
1cd5A           LFMKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTI
1i1qA           GAVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGIVLDSVPQSEADET--------RNKARAVLRAIAT
1gm5A1          ----------SLFLWGEALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKELDDPLLENKDLEEKLQAFLDY
1l7lA           DAFCGALVM---KIGNSGTIPVNTGLFR-------WVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGK
1cr0A           ESVEETAED-----LIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAK
1bs2A1          ------------------------------------------------------YAHSRLRSVERNASGI
2fggA1          --------------------------------------KTCQIDVLIEEHDERTRAKARLSWAGRQXVGV
3cddA1          --------------------------------------------AARGRFSWRQRFSKFTIKAAKADVTD
1dhyA1          --------------------------------------LGFAVKDVPAWDHFLTKSVGLMAAGSAGDAAL
1f8xA           --------------------------------------------------------AGWFTDRQNKAYKE
1fl9A           KM----IYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGINIDYYDDARNIELIAQTNLGKNI
1em8A           ----------------------------------------------------------------------
1v47A1          -----------------------------------------------------------------PALEI
1g8fA3          TELLSLIQDFIGSGSGLIIPDQ----WEDDKDSVVGKQNVYLLDTSSSAD-IQLESADEPISHIVQKVV-
1yr6A1          DVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLFHEFGVRL
1mkyA1          DNPQDIISQKXKEVTLNXIRELVLFVVDGKRGITKEDESLADFLRKSTVDTILVANKAENLREFEREVKP
1bccF           WYYNAAFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQQILP---KEQWTKYEED
1ovmA2          ELLHHTLGDGEFRHFYHMSEPITVA------QAVLTEQNACYEIDRVLTTMLRERRPGYLM--LPADVAK
1o7d.2          -----------------------------------------------------------YNPLGRKVDWM
1odfA           GYASIDDFYLTHEDQLKLNE--------QFKNNKLLQGRGLPGTHDMQDTVVLPKYDKSQFKGEGDRCPT
1t9hA2          EELGYTFPDIREKSSSCKFRGCLHLKEPK--------CAVKQAVEDGELKQYRYDHYVEFMTEIKDR---
1ckvA           ELLGRQFNVYDFLVDVSS----------------------------------------------------
2gtlM1          PSSLFVCAHFNAQRY-------------------------------------------------------
1ii8.1          VKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLERIALGLAFRLAM
1yvuA2          LKKXIPSQVILNRT--LKNENLKFVLNVAEQVLAKTGNIPYKLKEIEKVDAFVGIDISRITRDGKTVNAV
1sbxA           ------------------------------------------------------FXPSDRSTERCEGETI
1xl3C1          -----------YDLSEFMGDIVALVDXRWAGIHDIEHANAFSLPTYQDLXRMFRLFPLGVFSDEEQRQNL
1tueA           TKV-AMLDDATTTCWTYFDTYMRNALDGNPIIHPAKDNRWPYLESRITVFEFPNAFPFDKNG--------
1b77A2          RPKYTDYDGSNNFNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYVIAEADSTHD---------
2gujA1          EEVPFTFEDFDVPEKL------------------------------------------------------
1yj5A2          AALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXPVSDXVXFSYRKQF
1vplA           RKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLI
1vhhA           --------------------------------------KLTPLAYKQFIPNVAEKTGKITRNSERFKELT
3cddA2          YDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIEPFQRIQIEQGETPHELL
1d8jA           ------------------------------------------GDTHPLTLDEILDETQHLDIGLKQKQWL
1g6hA           LYHYRTFQTPQPLKEMTVLENLLIGEIKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEI
1iqrA2          --------------------------------------ALLEALARGPVVGLVVLDPNNLKTTPRRRAWF
1mi8A           KEHIALPRKSDISWDSIVSITETGVE--------------------------------------------
1q3tA           DQHPISFGRSETGDQLVFVGDVDITHPIR---ENEVTNHVSAIAAIPEVREKLVSLQQEI-AQQGGIVMD
1w1wA           KDYSIFLENNFLVFQGDVEQIAAQSPVELSRMFTFDYVSDHAIYRELTGNKYHATPPLKLSGGEKTVAAL
2vnuD1          ----------------------------------------------------------------------
1e2hA           NIYTTQHRLDQGEISAGDAAVVSAQITMGMPYAVTDAVLAPHIGGEAALTLIFDRHPIAALLCYPAARYL
1a4iA2          ----------------------------------------------------------------------
1jqjA3          DVLNALKCENVRM-MLTDSVSSVQI---------------------------------------------
1iioA           ------------------GSHMKMGVKEDIRGQIIGALAGADFALPNGPDTTCKSGDVELKASDAGQVLT
2je6I3          I---------------------------------------------------------------------
1esmA           PEHRRVELITTDGFLHPNQVLKERGLXKKKGFPESYDXHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPD
1ckeA           SHLDVRFVSTNGNLEVILEGED-------VSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLI
1pgsA2          LGCSANPINNQSPGN-WTPDRAGWCPGM------------------------------------------
1p5zB           ERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDR--YIFASNLYESECMNETEWTIYQD
1g8yA           GELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEG
1l1oA           EVVGRVTAKATIL-CTSYVQF-------KEDSHPFDLGLYNEAVKI--IHDFPQFYPLGI----------
1zbsA1          ----------------------------ILGTGSNSCLFDGREIKANPLGYILGDEGSGAVLGRLFIGSL
1oa8A           ----------PYFMKGSIIQLAELKKVEDLKTEDFIQSAEISNDLKIDSSTVERVAVIQFAVGEHRAQVS
1j90A           KKWAMPFQSYVTLTMLQSHTAPTNK---------------------------------------------
1heiB1          KFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQ--------------------------------
1g31A           ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------EIHFGALEGALW
1e6vC           ----------------------------------------------------------RKYMNPNYELKK
4tmkA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1jqjA2          --------------------------------------RLIEATQFSMAHQDVRYYLNRTVATDGHRLAV
1xzpA1          ALNLLDEVTGRSFR-EDLLDTI------------------------------------------------
1puoA2          ANGNELLLDLSLTVNATEPERTAMKKQDCYVENGLIS-RVLDGLVMTTISSS------------------
1lnzA2          ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1oy5A           -----------------------------------------------------------LSGGEIVALAV
1rz3A           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAW
1sgwA           ASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSREELSYCDVNE-------------
1b0uA           ARALAMEPDVLLFDEPTSALDPELVGEVL-RIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEE
1l7vC           AAVVLQITPLLLLDEPXNSLDVAQQSALDKILS-ALCQQGLAIVXSSHDLNHTLRHAHRAWLLKGGKXLA
1t06A           SWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSAMNNFLNTVVPLHEKAVEIAKEVGIVEVKRDNK
1e69A           ALLFALMEPFYVLDEVDSPLDDYNAERFKRLLKE--NSKHTQFIVITHNKI-VMEAADLLHGV-------
1m3eA1          ASKPREVREFNGQHFILEEAIRGDFALVKAWK--ADQAGNVTFRKSARNFNLPXCKAAETTVVEVEEIVD
1ji0A           GRALXSRPKLLXXDEPSLGLAPILVSEVFEVI-QKINQEGTTILLVEQNALGALKVAHYGYVLETGQIVL
1ex6A           RFLFIAPPSVEDLKKRLEGRGTETEESINKRLLAYAETGAHDKVIVNDDLDKAYKELKDFIF--------
1e9rA           MRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDP
1q3hA           ARAVYKDADLYLLDSPFGYLDVFTEEQVFESC--VCKLMANKTRILVTSKMEHLRKADKILILHQGSSYF
1nijA1          CQRYLLDGVIALVDAVHADEQMNQFTIAQ----SQVGYADRILLTKTDVAGEAEKLHERLARINARAPVY
1n25A           RPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMK-
1mukA           ARVVNLAVPDTWMSLDFDSMFKHHVKLLP----------KDGRHLNTDIPPRMGWLRAILRFLGAGMV--
1jalA1          ADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRSVGLDKEELQAIKSYNFLTLKPTMY
1pv4A3          PAVLTGGVDANALHRPKRFFGAARNVEEG------GSLTIIATALIDTGSKXDEVIYEEFKGTGNXELHL
1ohcA1          AFLVGCYMVIYLGRTPEEAYRILIFGETSYIPAYGSCNFYITLLDCFHAVKKAMQ---------------
1khbA1          EPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLV---YEALSWQHGVFVGAAMRSE
1pf4A1          ARALLRDAPVLILDEATSALDTESERAIQAAL--DELQKNKTVLVIAHRLS-TIEQADEILVVDEGEIIE
1jjvA           VVPLLIENKLTALCDRILVVDVSPQTQLARS---ANFEQIQRIMNSQVSQQERLKWADDVINNDAELAQN
1s9hA           QQPLQDRMFKFELTRRLDHDFGKVTKQEVKDF---FRWAKDHVVEVEHEFYVK-----------------
2yyeA2          LSDPVTSGGLLFTINKEKLEK-------------------------------------------------
1grqA           VRC-----DGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHIECAWAIAAH-----------
1bgxT2          PRQLALIKELVDLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLI
2gx8A1          VAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGHNVEMKQGVQKQLQEKVDAKKLN
1xbtA1          AESVVK----------------------------------------------------------------
1qhlA           LRSASDRSKFYRLIEAYGGISSAITRSLRDY---------------------------------------
1rkbA           FQVLYEEATASYKEEIVHQLPSNKPEELENNV--------------------------------------
1urjA           AGDAALALMAVFDEPPTDISAWPLFEARANAVGAYLARAAGLVGAMVFSTNSHLTEVDDA----------
1ffhA2          MGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTKPIYF
2v3jA1          TDHLPTKCRKVTLSFDAPVIRVQDYIEKLD------DDESICVFVGAGKDNFADEYVDEKVGLSNYPLSA
1poiA           PDDKFKYIDNPFKPEKVVAVPVPQVDVAIIHAQQASPDGTVRIWGGKFQDVDIAEAAKYTIVTCE-----
1kgdA           PFVVFIAAPTITPGLNEDESLQRLQKESDILQ--RTYAHYFDLTIINNEIDETIRHLEE-----------
2axpA1          YREVXSNAGLHTYSWDTGQWSSDIAKDIIFLV--------------------------------------
1zp6A1          GDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINAL------------------------
2iqhA1          PACVYGSAVASGYDFEREGYSLVGIDPF-------RLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFE
1j1zA2          LQRL----NEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRDMLSPK
1ni3A1          DVDPIR--DLSIIVDELLIKDAEFVEKHLEGLRKITSRGANTL---------------------------
1e6cA           MEAVLREREALYQDVAHYVVDATQPPAAI-----------------------------------------
1zs3A1          TTEEFLKYHKFITEDPKAKYWTD--EDLLESF---IVDFQAQNMFITRAIKLANKEEK--FALAAGVVEL
1f46A           AQHIADEVGGVVLDDQRRMMTPQKLREYQDII--------------------------------------
1bmfA3          LRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAY--IPTNVISITDGQIFL
1jb1A           EVAAXNFRAKSXGYDATKTFEKNLNHLI------------------------------------------
1t3wA           DSLLELRQEELIARERTHGLSNEERLELWTLN--------------------------------------
1mjgM           AKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDMRGLTDETVDTFYSFAPNHVCITPERVGL
2gk3A1          ISDIGSNTFLLQNETFYQLKIKPNALESIKEY----VKNGGGLLXIGGYLSXGIEAKANYKNTVLAEVLP
1ak2A1          RRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILA-----------
1udwA           IL-AFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYAD
1g6oA           SNSAARNIKESLIEGFKDLID-------------------------------------------------
2f9hA1          STLIFA-------DAPTDEDDVIRNGVYLTPHQLPKITIGTTIDYL------------------------
1afrA           ATFISHGNTARQAKEHGDIKLAQICGTI-------AADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMR
1c4oA1          REYRARNLVGFVLFPATHYLSPEGLEEIL-----------------------------------------
1qhdA1          ----------------------------------------------------------------------
1viaA           RLSKYEQKANFILNIENKNIDELLSE--------------------------------------------
2vgmA3          AAEYGAISYLLLTDKVLHSDNIAQREEYLKL-MDSVESNGGKALVLSTLHSLGEELDQLTGIACILK---
1f2t.1          SLYLAGEISLLILDEPTPYLDEERRRKLITIME-RYLKKIPQVILVSHD-EELKDAADHVIRIS------
1lw7A2          SXIKEYPFDVTILLKN------------------------------------------------------
1tmkA           PDVGLLKPDLTLFLSTQFGDERYETVKF---------QEKVKQTFMKLLDKEIRKGDESITIVDVTNKGI
1jbkA           DAALERRFQKVFVAEPSVEDTIAILR--------------------------------------------
1np6A           FRDGAGHRPEELVIDRHVIAVADVPLNLDVALLDINDVEGLADFVVEWMQK-------------------
1tljA           ELRTGIRMVHLLRESNTERVDKDKIKTLVNVC-NEVLARGKQKMNLLK----------------------
1es6A2          LKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL-------------------------
1e3mA2          EKXEGVANVHLDALEH----GDTIAFXHSVQDGAASKSYGLAVGVPKEVIKRARQKLRE-----------
1l3aA           RKVLKVE---PLPDGSGHFFNLSVQNKLINLD------ENIYIPVTKAEFAVLVSAFNFVMPYLLGWHT-
1dnpA2          NAQLNGLQIALEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYEVNERARDVEVERALRNVVC
1atrA1          AGTIAGLNVLRIINEPTAAAIAYGLD--------------------------------------------
1mm8A           AQEF----PELLAIEDTTSLSY--RHQVAEELGKLGSIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWM
1d6jA           VEVYVDVPVEAPYEAPANPNYELPVQDAVKQI--------------------------------------
2qgmA1          LKKXIGNAQYVGLGENTHGSSEIFTXKFRLV-KYLVTEXGFTNFAXEEDWGNGLKLNEYIQTGKGNPREF
2pa7A1          ILDDGNIIQEITLDSPAVGLYVGPAVWHEMH---DFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAK--
2ancF1          AERLRMSRQKQRHDALISKLL-------------------------------------------------
1cd5A           SCLQLHPKAIMVCDEPSTMELKVKTLRYFNEL--------------------------------------
1i1qA           AH--------------------------------------------------------------------
1gm5A1          VKEIPN------LPEARKRYRIQKSLEMIEKL--------------------------------------
1l7lA           DQ--------------------------------------------------------------------
1cr0A           LAYMGLGCDVIILDHI--SIRKMI-DNLMTKLKGFAKSTGVVLVVICHDLRALRQLSDTIIALERNQL--
1bs2A1          TQEKWINADFSLLKEPAAKLLIRLLGQYPD-VLRNAIKTHEPTTVVTY---LFKLTHQVSSCYDVLWVAG
2fggA1          GLAR-----LDPADEPVAQIGDELAIARA------LSDLANQLFALTSSDIEAST---------------
3cddA1          SEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTVTGWRIPQTGKLWNINTLVPVIDEI---
1dhyA1          YRADQRAWRIAVQPGELDDLAYGLEVDDAAALERMADKLRQAGVAFTR--GDEALMQQRKVMGLLCLQDP
1f8xA           AMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNG-IKTNDIMLGVYIPDEED
1fl9A           ISAF------------------------------------------------------------------
1em8A           ---------FYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVP
1v47A1          GEDERLD-LENLATGAFFPVKGFMTREEALSVAHEMRLPTTIPILLQFREKPRVGPGNTVALLHGGERVA
1g8fA3          ----------------------------------------------------------------------
1yr6A1          MENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALNK----------------------
1mkyA1          ELYSLGFGEPIPLDTXLETIIKKLEEKG------------------------------------------
1bccF           VPYLEPYLKEVI----------------------------------------------------------
1ovmA2          KAA-------------------------------------------------------------------
1o7d.2          VRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFS--ALVPAVGFSI-YSVSQMPRDLVIQNEYL--
1odfA           GQKIKLPVDIFILEGWFLGFNPILQGIE------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1ii8.1          SLYLAGEISLLILDEPTPYLDEERRRKLITI-MERYLKKIPQVILVSHDEE-LKDAADHVIRISLENGSS
1yvuA2          AFTKIFNSKGELVRYYLTSYPA-FGEKLT--------EKAIGDVFSLL-EKLGFKKGSKIVVHRDGRLYR
1sbxA           SCFVVGGEKRL---CLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVXGILPFSPSCGLIT
1xl3C1          LQMCQNAIDMAIESE-------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1yj5A2          EPPTLAEGFLEILEIPFRLQEH-LDPALQRLY--------------------------------------
1vplA           ARALMVNPRLAILDEPTSGLDVLNAREVRK-ILKQASQEGLTILVSSHNMLEVEFLCDRIALIHNGTIVE
1vhhA           PNY---NPDIIFKDEENTGADRLMTQRCKDKLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVD
3cddA2          ARLAKQR-GVLLTSDTFGNLVIT-----------------------------------------------
1d8jA           MTEALVNNPIEVIDGKYAFKPKYNVR--------------------------------------------
1g6hA           GRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKG-ITFLIIEHRLDIVLNYIDHLYVMFNGQIIA
1iqrA2          LENVRA------LREAYRARGGALWVLEGLPWEKVPEAARRKAVYALTSHTPYGRYRDGRVREA------
1mi8A           ----------------------------------------------------------------------
1q3tA           GRDIGT---VVLPQAELKILVASVDERA------------------------------------------
1w1wA           ALLFYQPSPFFVLDEVDAALDITNVQRIAAYIRRH-RNPDLQFIVISL----------------------
2vnuD1          ----------------------------------------------------------------------
1e2hA           MGSMTPQAVLAFVALIPPTLPGTNDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLLANTVRYLQCGGSWR
1a4iA2          ---------EILNGKE---ISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEE
1jqjA3          ----------------------------------------------------------------------
1iioA           ADDFPKSAEEVADTIVNKA---------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1esmA           GDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDAPE-DLLQTWYINRFLKFREGAFTD
1ckeA           ADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTLS--
1pgsA2          ----------------------------------------------------------------------
1p5zB           WHDWMNNQFGQSLELDGIIYLQATPETCL-----------------------------------------
1g8yA           RRLMVLDTLRRFHIEEENASGPM-AQVIGRMEAIAADTGCSIVFLHHAVLVDNIRWQSYLSSMTSAEAEE
1l1oA           ----------------------------------------------------------------------
1zbsA1          LKGQXPEG---LCEAFLQEYGLTSADIIESVY---RKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNSFDD
1oa8A           VEVLV-EYPFFVFGQGWSSCCPERTSQLF---DLPCSKLSVGDVCIS-----------------------
1j90A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1g31A           LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVQGEVPELCVVHSVDVPEGFCEVGDLTSLPVGQI--
1uouA3          ---------------------REQEELLAPADGTVELVRALPLALVLHELGALRLGVGAELLVDVGQRLR
1v37A           ETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTH----------------------
1e6vC           LREIPDEDIVRLMGHREPGEEYPSV---------------------------------------------
4tmkA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1jqjA2          CSMPIGQSPRKGVIELMRMLD-------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1oy5A           IDAVSRVLPGVLSEPYPVYTRPR-----------------------------------------------
1rz3A           ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QGMTNExxxxxxxxxxxxxxxx
1sgwA           ----------------------
1b0uA           EGDPEQ----------------
1l7vC           SGRREE----------------
1t06A           KS--------------------
1e69A           ----------------------
1m3eA1          IG--------------------
1ji0A           EGKASE----------------
1ex6A           ----------------------
1e9rA           NGG-------------------
1q3hA           YGTFSE----------------
1nijA1          TVTHGD----------------
1n25A           ----------------------
1mukA           ----------------------
1jalA1          IANVNE----------------
1pv4A3          SR--------------------
1ohcA1          ----------------------
1khbA1          AKIIMH----------------
1pf4A1          RGRHAD----------------
1jjvA           LPHLQQ----------------
1s9hA           ----------------------
2yyeA2          ----------------------
1grqA           ----------------------
1bgxT2          TP--------------------
2gx8A1          VHIHAS----------------
1xbtA1          ----------------------
1qhlA           ----------------------
1rkbA           ----------------------
1urjA           ----------------------
1ffhA2          AG--------------------
2v3jA1          SVACSK----------------
1poiA           ----------------------
1kgdA           ----------------------
2axpA1          ----------------------
1zp6A1          ----------------------
2iqhA1          DLRVSS----------------
1j1zA2          YAELVY----------------
1ni3A1          ----------------------
1e6cA           ----------------------
1zs3A1          YG--------------------
1f46A           ----------------------
1bmfA3          ET--------------------
1jb1A           ----------------------
1t3wA           ----------------------
1mjgM           CGAVSW----------------
2gk3A1          VIXLDG----------------
1ak2A1          ----------------------
1udwA           VII-------------------
1g6oA           ----------------------
2f9hA1          ----------------------
1afrA           KKISMP----------------
1c4oA1          ----------------------
1qhdA1          ----------------------
1viaA           ----------------------
2vgmA3          ----------------------
1f2t.1          ----------------------
1lw7A2          ----------------------
1tmkA           QEVEAL----------------
1jbkA           ----------------------
1np6A           ----------------------
1tljA           ----------------------
1es6A2          ----------------------
1e3mA2          ----------------------
1l3aA           ----------------------
1dnpA2          EGFDDS----------------
1atrA1          ----------------------
1mm8A           RP--------------------
1d6jA           ----------------------
2qgmA1          LKLLYP----------------
2pa7A1          ----------------------
2ancF1          ----------------------
1cd5A           ----------------------
1i1qA           ----------------------
1gm5A1          ----------------------
1l7lA           ----------------------
1cr0A           ----------------------
1bs2A1          QTEELA----------------
2fggA1          ----------------------
3cddA1          ----------------------
1dhyA1          FGLPLE----------------
1f8xA           VGLGME----------------
1fl9A           ----------------------
1em8A           HNLAGE----------------
1v47A1          LL--------------------
1g8fA3          ----------------------
1yr6A1          ----------------------
1mkyA1          ----------------------
1bccF           ----------------------
1ovmA2          ----------------------
1o7d.2          ----------------------
1odfA           ----------------------
1t9hA2          ----------------------
1ckvA           ----------------------
2gtlM1          ----------------------
1ii8.1          KV--------------------
1yvuA2          D---------------------
1sbxA           KTDAER----------------
1xl3C1          ----------------------
1tueA           ----------------------
1b77A2          ----------------------
2gujA1          ----------------------
1yj5A2          ----------------------
1vplA           TGTVEE----------------
1vhhA           ITTSDR----------------
3cddA2          ----------------------
1d8jA           ----------------------
1g6hA           EGRGEE----------------
1iqrA2          ----------------------
1mi8A           ----------------------
1q3tA           ----------------------
1w1wA           ----------------------
2vnuD1          ----------------------
1e2hA           EDW-------------------
1a4iA2          IGIKAT----------------
1jqjA3          ----------------------
1iioA           ----------------------
2je6I3          ----------------------
1esmA           PDSYFH----------------
1ckeA           ----------------------
1pgsA2          ----------------------
1p5zB           ----------------------
1g8yA           WGVDDD----------------
1l1oA           ----------------------
1zbsA1          FLVRNV----------------
1oa8A           ----------------------
1j90A           ----------------------
1heiB1          ----------------------
1g31A           ----------------------
1uouA3          RGTPWL----------------
1v37A           ----------------------
1e6vC           ----------------------
4tmkA           ----------------------
1tpzA           ----------------------
1jqjA2          ----------------------
1xzpA1          ----------------------
1puoA2          ----------------------
1lnzA2          ----------------------
1f6bA           ----------------------
1oy5A           ----------------------
1rz3A           ----------------------
2cxxA1          ----------------------
1xzpA2          ----------------------
1zd9A1          ----------------------