[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ecol0:AAC75368.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG1.bssp"
#ERROR : Can't open dsspfile "2r6gF2.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"
#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "1tluA.bssp"

## Summary of PDB Search
:228
    1e-19  15%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    2e-13  16%  2r6gF2 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALF
    7e-12  14%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
    3e-10  18%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    3e-10   8%  1tluA  [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNRLSGLIFEGYTTLIRGVPDLVLMLLIFY
2r6gG1          -----------------------------------------------TLLKGMLIFQMFPAVLSLVALYA
2r6gF2          ----------------------------------------------------------------------
2onkC1          -----------------------------------------------VVEGIVDLPVVIPHTVAGIALLV
3dhwA1          -----------------------------------------NAKLYRTVSAIVNIFRSIPFIILLVWMIP
1tluA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTRGQVFRR
2r6gG1          LFD-------RLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRL
2r6gF2          -------------------TTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFK
2onkC1          VFGSSGLIG---SFSPLKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFT
3dhwA1          FTRVIVGT-----------SIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRK
1tluA           --------------------------LGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFH


                         +         .         .         .         .         *         .:210
query           IMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQLAGKSTWEPFYFAIVCGVIYLVFTTVSNG
2r6gG1          VLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGNPQNYLWGDFAAAAVMSALPITIVFLL
2r6gF2          ITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYR-------------
2onkC1          VSLPLSVRHIVAGAIMSWARGISEFGAVVVIAYYPMIAPTLIYERYLSEGL-------------------
3dhwA1          VLLPEALPGLVNAATITLITLVGYSAMGGAVG--------------------------------------
1tluA           RFLPYGVSGVVVISESHLTIHTWPEYGYAAIDL-------------------------------------


                         .         .         .         +         .         .         .:280
query           VLLFLERRYSVGxxxxxx
2r6gG1          AQRWLVNGLTAG------
2r6gF2          ------------------
2onkC1          ------------------
3dhwA1          ------------------
1tluA           ------------------