[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for ecol0:AAC77002.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG1.bssp"
#ERROR : Can't open dsspfile "2r6gF2.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"
#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "1tluA.bssp"

## Summary of PDB Search
:296
    2e-35  98%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    3e-20  24%  2r6gF2 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALF
    8e-16  21%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
    4e-14  17%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    1e-08  13%  1tluA  [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
:296

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNFATGSLIPEQISWDHWKLALGFSVEQA
2r6gG1          ------------------------------------------NFATGSLIPEQISWDHWKLALGFSV---
2r6gF2          ----------------------------------------------------------------------
2onkC1          -----------------------------------------------TVTLQLFNFDEFLKAASDP----
3dhwA1          ----------------------------------------------------------------------
1tluA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
2r6gG1          -ITPPPFPV--LLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVAL
2r6gF2          ---------PFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIF
2onkC1          ---------AVWKVVLTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIAL
3dhwA1          ----------LVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPF
1tluA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
2r6gG1          YALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPL
2r6gF2          KGLFNQSFGEINMMKPAWFSDPTTARTMLIIVNTWLCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPL
2onkC1          LVVFGSSGLIGSFSPLKFVDALPGIVFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPL
3dhwA1          IILLVWMIPFTRVIVSIGLQAAIVPLVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPE
1tluA           ---------------------LGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPY


                         .         .         .         +         .         .         .:280
query           SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
2r6gG1          SVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
2r6gF2          LIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLEGGGGQDFGLAAAIATLIFLLVGAL
2onkC1          SVRHIVAGAIMSWARGISEFGAVVVIAYYPMIAPTLIYERYLSEGLSAA---------------------
3dhwA1          ALPGLVNAATITLIT-------------------------------------------------------
1tluA           GVSGVVVISESHLTIHTPEYGYAAIDLFTCGEDVDPWKAFEHLKKAKAKRVHVVEHERGRYDEI------


                         .         *         .         .         .         .         +:350
query           AQRWLVNGLTAGGVKG
2r6gG1          AQRWLVNGLTAGGVKG
2r6gF2          A---------------
2onkC1          ----------------
3dhwA1          ----------------
1tluA           ----------------