[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ecol0:AAC73143.1


[Show Plain Result]

## Summary of Sequence Search
   1::382
   4::133  PF00988 0.0% 58.4615384615385  Carbamoyl-phosphate synthase small chain, CPSase do 
 197::372  PF00117 0.0% 36.3636363636364  Glutamine amidotransferase class-I 
 249::355  PF07722 0.0% 29.8076923076923  Peptidase C26 
   1::382


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
PF00988         ---kavLvLedgtvfeGesfgaegeavGEvvfntsmtGYqeiltdpsYagqivvftypliGnyGvneedl
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
PF00988         eskkiavkglivrelseepsnwrseesleeflkeegipgisgvDTRalvrklrekGamkgviv-------
PF00117         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
PF00988         ----------------------------------------------------------------------
PF00117         --------------------------------------------------------iDnydsvtknlara
PF07722         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
PF00988         ----------------------------------------------------------------------
PF00117         lrelgvkvevvpndadaeeileklknpdgilisgGpgspgavegkieaikearenkiPiLGICLGmQlla
PF07722         --------------------------------------afelaLiraalergvPvlgiCrGlqllnvalg


                         -         *         -         -         -         -         +:350
query           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
PF00988         ----------------------------------------------------------------------
PF00117         iefggkvikekkeehmggnmrlghdgkaallyglpnevivrhrHsyevnpkellpeglevtaksedggei
PF07722         gtlyqdikeepglsdhreheqdasshavslekgsllarllgaeeievnslHhqaike..lakglevlAta


                         -         -         -         -         *         -         -:420
query           QGHPEASPGPHDAAPLFDHFIELIEQYRKTAK--------------------------------------
PF00988         ----------------------------------------------------------------------
PF00117         maivekknpivgvQFHPEssst------------------------------------------------
PF07722         e.dgv-----------------------------------------------------------------