[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ecol0:AAC73177.1


[Show Plain Result]

## Summary of Sequence Search
   1::232
  39::157  PF00005 0.0% 36.6071428571429  ABC transporter 
  27::190  PF02463 0.0% 24.6835443037975  RecF/RecN/SMC N terminal domain 
  25::48   PF03193 0.0% 33.3333333333333  Protein of unknown function, DUF258 
   1::232


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGSLTIDGVDHTTMPPSR
PF00005         --------------------------------------STLlklltgelkptegeievdn.drkdlesdk
PF02463         --------------------------ftaivGpNGSGKsnvldAilFvLGeksakklrseklsdlihksk
PF03193         ------------------------dktsvlvGqSGvGKSsLinallpe----------------------


                         -         -         *         -         -         -         -:140
query           RPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQGKMHAIARQMGIDNLMARLPGELSGGQRQRVAL
PF00005         leklr.igyipqdpllfpeltvrenldmakeekk.....tdkrieevlekvgldelldksrvstLSgGqk
PF02463         skakvksaeveitfdnedkelvieeeevsitrrvkrkgeseykingkevtk.kevaellesagiske...
PF03193         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAW
PF00005         qrvalArallkkpklll-----------------------------------------------------
PF02463         lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellke--------------------
PF03193         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QGMTNELLSGKASASALLGITG------------------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------