[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ecol0:AAC74699.1


[Show Plain Result]

## Summary of Sequence Search
   1::193
   1::191  PF02508 0.0% 54.4973544973545  Rnf-Nqr subunit, membrane protein 
   1::193


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLI
PF02508         mkellsillsailvnnlvlvqfLGlCpfLavskkvetalglGlAvtfVlvlsnllvsllrnlilap..le


                         -         -         *         -         -         -         -:140
query           YLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSA
PF02508         flriivfilviAalVqlvemvlkkfvpalykslgiFlpLIvtnCavlgraeafaskenslleslvdglga


                         +         -         -         -         -         *         -:210
query           AVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL-----------------
PF02508         GlGftlalvllagiReklglgdvpkelqgllialltagllalaFmgfsgli-------------------