[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ecol0:AAC75368.1


[Show Plain Result]

## Summary of Sequence Search
   1::228
  28::219  PF00528 0.0% 21.3483146067416  Binding-protein-dependent transport system inner me 
   1::228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVPDLVLMLLIFY
PF00528         ---------------------------illGilaa...lnrnkkldkllrpliivlsslPsfvlaillvl


                         -         -         *         -         -         -         -:140
query           GLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTRGQVFRR
PF00528         vf...........vilsilghlilpviillllsaapyvrlirraalrslpkdlveaaralGasrwqifrk


                         +         -         -         -         -         *         -:210
query           IMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQLAGKSTWEPFYFAIVCGVIYLVFTTVSNG
PF00528         vvlPnalppiitglilafggllggavlleflgswpGlgtllleailgydyseisnggvlalviavlllnl


                         -         -         -         +         -         -         -:280
query           VLLFLERRYSVGVKRADL----------------------------------------------------
PF00528         vadilqrll-------------------------------------------------------------