[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ecol0:AAC77012.1


[Show Plain Result]

## Summary of Sequence Search
   1::122
  16::118  PF01219 0.0% 49.5145631067961  Prokaryotic diacylglycerol kinase 
   1::122


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLISSVMLVMIVE
PF01219         ---------------kyalkGlkaalkeeaafrielllalvvlilalllelsavewlllllaillvlivE


                         -         -         *         -         -         -         -:140
query           ILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVITWCILLWSHFG------------------
PF01219         llNtaiEavvDlispeyhelakkaKDiaaaavlvalilavivgllill----------------------