[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ecol0:AAC73143.1


[Show Plain Result]

## Summary of Sequence Search
   1::382
 153::380  2.7e-71 36.8% 0045752 00457521 1/1    I glutamine amidotransferase-like      
   2::152  1.1e-56 55.0% 0034973 00349731 1/1   moyl phosphate synthetase, small subuni 
 191::374    1e-55 40.3% 0042722 00427221 1/1    I glutamine amidotransferase-like      
 187::382  3.9e-54 39.0% 0049298 00492981 1/1    I glutamine amidotransferase-like      
 193::381  2.7e-53 33.5% 0047949 00479491 1/1    I glutamine amidotransferase-like      
 187::380  4.6e-52 37.0% 0038211 00382111 1/1    I glutamine amidotransferase-like      
 191::383  8.6e-50 41.7% 0051730 00517301 1/1    I glutamine amidotransferase-like      
 190::378    5e-49 33.2% 0048482 00484821 1/1    I glutamine amidotransferase-like      
 192::377  6.5e-49 37.2% 0047286 00472861 1/1    I glutamine amidotransferase-like      
 190::377  9.7e-49 39.0% 0047324 00473241 1/1    I glutamine amidotransferase-like      
 192::376    4e-46 34.3% 0050645 00506451 1/1    I glutamine amidotransferase-like      
 193::378  1.6e-45 32.2% 0050138 00501381 1/1    I glutamine amidotransferase-like      
 192::374  8.4e-37 35.4% 0039782 00397821 1/1    I glutamine amidotransferase-like      
 189::383    5e-33 32.0% 0043181 00431811 1/1    I glutamine amidotransferase-like      
 190::377  1.4e-32 30.7% 0039988 00399881 1/1    I glutamine amidotransferase-like      
 192::361  8.1e-29 29.3% 0047771 00477711 1/1    I glutamine amidotransferase-like      
 191::379  2.3e-26 25.0% 0052900 00529001 1/1    I glutamine amidotransferase-like      
 203::317  8.7e-22 32.2% 0041867 00418671 1/2    I glutamine amidotransferase-like      
 192::327  1.3e-21 28.6% 0037903 00379031 1/1    I glutamine amidotransferase-like      
 184::371    2e-20 29.3% 0042648 00426481 1/1    I glutamine amidotransferase-like      
 188::376  3.5e-15 26.3% 0051742 00517421 1/1    I glutamine amidotransferase-like      
 149::381  1.8e-12 25.7% 0048285 00482851 1/1    I glutamine amidotransferase-like      
 189::276  5.2e-11 30.6% 0046884 00468841 1/1    I glutamine amidotransferase-like      
 194::375  1.7e-09 20.6% 0049527 00495271 1/1    I glutamine amidotransferase-like      
 189::326  8.5e-08 25.5% 0042074 00420741 1/1    I glutamine amidotransferase-like      
 219::374  3.3e-05 23.9% 0042273 00422731 1/1    I glutamine amidotransferase-like      
 336::374       10 23.1% 0041867 00418672 2/2    I glutamine amidotransferase-like      
   1::382


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADE
00457521   1/1  ----------------------------------------------------------------------
00349731   1/1  -llkalLvledGtvflGlsfGalgevvGevvfntsmtGYqeiltdPsyagqilvltyPliGnyGvnsedl
00427221   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00418671   1/2  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00482851   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00495271   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00422731   1/1  ----------------------------------------------------------------------
00418672   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDA
00457521   1/1  ----------------------------------------------------------------------
00349731   1/1  esekilvaGlvvrelallpsnwrallslseylkeegvpgisgidtRaLtrllrekGallgvivlelddle
00427221   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00418671   1/2  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00482851   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00495271   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00422731   1/1  ----------------------------------------------------------------------
00418672   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLV
00457521   1/1  ------------leglgllelvlvlllldlleldlvawvsllelllnpggevriavidygsfynilralr
00349731   1/1  llllllkellel----------------------------------------------------------
00427221   1/1  --------------------------------------------------mkkiliidfgdsflynlvra
00492981   1/1  ----------------------------------------------kkevkiavvgdygsltgnllsile
00479491   1/1  ----------------------------------------------------agkpvigvlpglvprilv
00382111   1/1  ----------------------------------------------ialvgkkilildfggsftenlvra
00517301   1/1  --------------------------------------------------mlkiliidfgdsftgsivra
00484821   1/1  -------------------------------------------------mmkmkilvldlpgsgnlqsia
00472861   1/1  ---------------------------------------------------mkvllldygdsfteslara
00473241   1/1  -------------------------------------------------mkilvldfygsnteslvralr
00506451   1/1  ---------------------------------------------------mkilvldfggsnleslara
00501381   1/1  ----------------------------------------------------mgkpvigilgkyilllda
00397821   1/1  ---------------------------------------------------gallkvivivdygsgnlrd
00431811   1/1  ------------------------------------------------kmkiavldfg.gnytsllralr
00399881   1/1  -------------------------------------------------mkilvidlggsnleslvdalr
00477711   1/1  ---------------------------------------------------kiivivdpgsgnlrdiara
00529001   1/1  --------------------------------------------------senifvmsedralrqdirpl
00418671   1/2  --------------------------------------------------------------alllskrl
00379031   1/1  ---------------------------------------------------kkilvllfdgfellelasp
00426481   1/1  -------------------------------------------lkaldgvkiavldfg.gnytsllralr
00517421   1/1  -----------------------------------------------aevligvlildggvgnhisvlaa
00482851   1/1  --------esklplpdlaednalfpsllslskllsslllleglllplllllmkkvlvvltsagvlmkkvl
00468841   1/1  ------------------------------------------------mkkllliggfrgdlslleplld
00495271   1/1  -----------------------------------------------------ilplakpkvavlvfpgs
00420741   1/1  ------------------------------------------------mkkvlvllagggvldgfellEa
00422731   1/1  ----------------------------------------------------------------------
00418672   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASG
00457521   1/1  elgaevevvpvdidaeelealdpdglilpGGpgdprrleglieairealeagkPvlGIClGhQllaealg
00349731   1/1  ----------------------------------------------------------------------
00427221   1/1  lrelgvevvvvpvdaltleeilllnpdglilpGGpgspydardegllelirealeagkPilGIClGhQll
00492981   1/1  alehagaevvvkveilwvpsdlleeeilellkgadgillpGGpgdpg.veglieairealengiPvLGIC
00479491   1/1  ldygsgnlyrsiaralreaGaevvvvpvdltleeipellddadglilpGGpsdvddlgalrrdeglleli
00382111   1/1  lrelgvevevvpvdadlleillldpdglilpGGpgsp.rdeglielirealeagkPvlGiClGmQllala
00517301   1/1  lrelgvevevvpndadleelle..pdgiilsGGpgspadeglllialiklalelgiPiLGiClGhQllal
00484821   1/1  ralreagvevvvvpaddltldeilledadglilpGGpgdpldlgalprieglielirealeagkpvlGIC
00472861   1/1  lrelgaevevvpvdlelletldeidlldpdglilpGGpgsvgde.glieairealeagvpvLGiClGhQl
00473241   1/1  elgaevevvpvdleletlpeelllldpdglilpGGpgspdllgl.leairealeagvpvLGiClGhQlla
00506451   1/1  lrelgaevevvpvdldleeillldadglilpGGp.svgda.glleairealealgkpvlGiClGmqllae
00501381   1/1  ydsvtaalylagrllgvgvevvvvgadvltleeipellddadglvlpGGpgspddlg.lleairealerg
00397821   1/1  laralrelgvevevvpid...edillldadglil.PGggstvddlrllrleglieairealeagkPvLGI
00431811   1/1  eagaevvvvsp....dedle.dadglilpGGpgtvyalllrdeglleaireaaeagkpvlGiClGmqlLa
00399881   1/1  elgaevevvrvdvldeedle.dadalil.PGggspadalrllrleglieaireaaesgkpvlGIClGmql
00477711   1/1  lrelgvevevvrdpedledadgiilpGgfstrgdlrllrlsglieairealergiPvLGIClGmQlLaea
00529001   1/1  rIllLnlmpkkidtevqflrllgaqplqveltllridshlskntaalhltrfyetfdlidlekfDgliit
00418671   1/2  sllllllllkllaskkilvllfdgfedlelvgpldalrragaevvvvspdgglpvvgshgllvvtadttl
00379031   1/1  lralreagaevevvspdggpvtssnglalladltldevdledyDalilpGGpgtvdllrdpgllelirea
00426481   1/1  elgaevvvvssled.....legadglilpGGfstvdllllrnsglleaireaaeagkPvlGiClGlqlLa
00517421   1/1  lerlgvevvvvrk..pedlk.didglilPGggsttiallallariglllalikfviakgkpvlGiClGmQ
00482851   1/1  illfdgfellElagpldvLrragyevdlaspdggpvpld.....plsvnildlgvksnfrnvlssaglal
00468841   1/1  llelltgdkpkigvipyagldldfegyyrsvldalerlGaevvvvslledpleaLp.daDglil.p----
00495271   1/1  ncdrdlaraferaGfeavlvhmsdllagrvllddfdglvlpGGf.sygdvlgggaiaaasllmndklela
00420741   1/1  vlpldaLrragaevtvaspdggqvhvvnhllgelegenrnvvvesagialvadltladvdladyDalvlP
00422731   1/1  --------vlpdatlddldpledyDalvlpGgfgaaddlrddpallellrefaeagkpvaaiChGpqlLa
00418672   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSF
00457521   1/1  gkvvrlkvghsgensplfkglggdviivyhsHgyavnleslpeglevlatslndglveaiehkdgpvfgv
00349731   1/1  ----------------------------------------------------------------------
00427221   1/1  alalggkvlklkvgelgwnsvvltlvtdgsllfkglgdelivyfyHsyavde..lpeglevlatslddgl
00492981   1/1  lGmQllavalggnvlglkdahsgefseetnhpvlgllpglvlrnallelvdslsdlggtmrlGwhpvvlv
00479491   1/1  realergdlkPvlGIClGmQlLaealggkvikgpggeegvvvpvellglllvstlflglpspllkgslla
00382111   1/1  lggkvlklkvpelglnsvvlvldgglfeglpgtlrlyfyhslivrhshgdavne..lpeglvvlats.dd
00517301   1/1  alggkvvklkvgelgwnsvvltlgsplfkglgevlivyfyHsyavde..lpeglevlats.ddgpveair
00484821   1/1  lGhQlLaealggkverlpegpelgllpvevtegsplfrglgdelrvyeiHsdvtelpeglevlats.edg
00472861   1/1  laealggkvlrlktgrlgwnsvvltegsplfkglgdvlivyfsHsyavte..lpeglevlats..dgtie
00473241   1/1  ealggkvlrlktgelgwnsvvltegsplfkglgdvlivyfsHgyavde..lpeglevlats..dgtieai
00506451   1/1  alggkvvrlkvpehgwvsviltdgsplfkglgdeltvy.fsHsyav..delpeglevlats.edgsieai
00501381   1/1  kpvlGIClGmQllaealggkveklpgaelglldpevtrnvvglleesfvlvellgvphlgwnpvalaegs
00397821   1/1  ClGmQlLaealggpgsvpglgllpgkvvrnkegrlvvphlgwnvvvldsplfkglgee..lrvyeiHsya
00431811   1/1  ealggkvvkglgllpgkvvteyrgltlpvvgadalfvglevvvhgyevhsdaveelpeglevlats.ddg
00399881   1/1  Laealggkvgvpglglldgktvrlykgrlphvgvngplfkglpdpltvy.eiHslrvev..lpdgllvla
00477711   1/1  lggpvgleglgllgggvlllgtlrlphmgwnllelplllgigegvygyevhsyrtlpnglavlaltedgv
00529001   1/1  GgpvsvldfedvpwleelkellkwalenkkptLGiClGaqllayalggkvkkalpgkefGvfpvtltddg
00418671   1/2  ddvdledyDalvlPGGfgaddlradeellelirefae---------------------------------
00379031   1/1  aeagkpvlgiClGaqlLaeagllggkvatthwleeeelpeaganvvd-----------------------
00426481   1/1  ealggpgvpglgllpgkver.............lalgrtvlslvgdlllpglgwnlrgyeihadlveglp
00517421   1/1  lLaeasgepgvleglgeigglgllditvvrnafgrqphsgwndlkikglsplfkgilnksifyfvhsyir
00482851   1/1  tpd...aslddvdlPedyDalilPGGfgaaddlrdnpellallrefaaagkpvaaiChGpqlLa.aaGdg
00468841   1/1  ----------------------------------------------------------------------
00495271   1/1  llkffarrgkpvLGiCnGfQlLvelgllpggdlldpaltrnasgrfesrwvtlrvenspsiflsgl.ags
00420741   1/1  GGfgaaknlrdgaiagellrvneellelirefaeagkpvaaiChGp------------------------
00422731   1/1  aaglldgrratthwalaed.......................................lkeagpdvvvde
00418672   2/2  -------------------------------------------------------rnaganfvdervvvd


                         -         -         -         -         *         -         -:420
query           QGHPEASPGPHDAAPLFDHFIELIEQYRKTAK--------------------------------------
00457521   1/1  qfHPEfslgplglrllfdnfleaalglkgs----------------------------------------
00349731   1/1  ----------------------------------------------------------------------
00427221   1/1  veaiehkdlpvfgvQfHPEsslgp----------------------------------------------
00492981   1/1  egsllfkgygkgliivrhrHsyavdplylpll--------------------------------------
00479491   1/1  piaygvhsyevneihgdaveelpeglvvlat---------------------------------------
00382111   1/1  glveaiehkdlpvfgvQfHPEstsgplg.l----------------------------------------
00517301   1/1  hkdlpifgvQfHPEvtstplg.lrllknFlela-------------------------------------
00484821   1/1  sieairhkd..vlgvqfHPE..fdsddg------------------------------------------
00472861   1/1  aielkdgpvlgvqfHPElsltplgl.r-------------------------------------------
00473241   1/1  elkdgpvfgvqfHPElsltplg.lrlf-------------------------------------------
00506451   1/1  elkdgpvlgvqfHPEftsgplg.lrl--------------------------------------------
00501381   1/1  llfkglgeeliverhrhryevhsdavdr------------------------------------------
00397821   1/1  vevndetlellpegllvlattedg----------------------------------------------
00431811   1/1  .ieaie..hgnvlgvqfHpeftsglr....llr-------------------------------------
00399881   1/1  rs..dgliegiehkdgnvlGvqfHPef-------------------------------------------
00477711   1/1  iagaavrdgnv-----------------------------------------------------------
00529001   1/1  dpllrglpdeftvphsrytehhddvielp-----------------------------------------
00418671   1/2  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00426481   1/1  egaevlavh..dg..agaavr-------------------------------------------------
00517421   1/1  apliedvgvtvavlsyggefiaavrk--------------------------------------------
00482851   1/1  kylld.GrraTthpaaeevavgltgitsgvv---------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00495271   1/1  vlpvpvaHgegvfeladdlvlaale---------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00422731   1/1  lvvvdgnliTsagpaaaidlalal----------------------------------------------
00418672   2/2  dgnliTsqgpgaaidfalalvelL----------------------------------------------