[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for ecol0:AAC73177.1


[Show Plain Result]

## Summary of Sequence Search
   1::232
  18::212  9.5e-59 38.5% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   1::234  9.7e-59 42.5% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   1::219  6.1e-58 42.9% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   1::230    9e-58 43.0% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   2::216  1.3e-57 43.6% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   1::231  1.5e-57 41.3% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   1::231  6.7e-57 42.4% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   2::231  8.3e-56 43.0% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   1::230  8.5e-55 36.3% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
  19::221  1.8e-54 42.3% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
  16::227  2.8e-54 44.6% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   1::234  3.8e-54 40.3% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   2::216  5.3e-54 39.3% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
  18::230  1.2e-53 43.4% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   3::221  1.6e-53 46.2% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   2::219  3.6e-53 41.9% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   1::217  6.8e-53 42.1% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
  18::216  2.1e-52 43.0% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   2::219  2.5e-52 42.0% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
  18::233  3.8e-52 42.7% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   2::219  4.9e-52 42.7% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   2::219  8.2e-52 43.3% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   2::220  1.7e-51 40.4% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
  17::222  2.6e-51 40.4% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   1::204  5.8e-51 44.2% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   1::218  2.4e-50 40.7% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   1::223  2.7e-50 41.5% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   1::222  1.2e-49 44.9% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
  18::217  3.9e-49 42.4% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   1::222  7.6e-48 41.5% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   1::218  1.5e-46 46.2% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
  19::223  2.5e-46 40.3% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
  19::212  6.7e-46 49.4% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
   1::219  1.1e-45 44.8% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   7::218  4.4e-45 42.5% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   1::199  4.8e-45 37.2% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   1::217  7.4e-44 43.2% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
  20::219  3.3e-43 42.2% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
   1::218  3.6e-43 40.5% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
  23::217    2e-42 44.1% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
   2::219  2.5e-42 36.6% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
  25::176  4.4e-42 48.7% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  17::219  5.6e-42 39.1% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  12::219  2.3e-40 45.1% 0053253 00532531 1/1   arboxykinase-like                       
  15::219  3.1e-39 41.1% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  19::223  3.5e-38 37.0% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   1::219  2.1e-36 34.9% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  24::224  7.7e-36 35.0% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
   1::212  1.2e-35 37.0% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  12::178  1.7e-35 45.9% 0047552 00475521 1/1   arboxykinase-like                       
  19::161  1.9e-35 47.5% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  18::193  2.4e-35 42.3% 0047841 00478411 1/1   arboxykinase-like                       
  23::202  3.7e-35 37.9% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  24::165  3.2e-34 47.5% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  14::210    5e-34 33.1% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  23::221  6.7e-34 39.5% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
   1::215  1.3e-33 39.4% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
   5::219  4.5e-33 30.1% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  23::208  2.6e-32 37.6% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  24::215  2.2e-31 34.4% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  19::217  1.4e-30 32.8% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  22::203  3.3e-30 38.2% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  24::182  3.9e-30 42.9% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  24::204  3.2e-29 35.6% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  22::216  5.3e-29 37.0% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  22::218  2.7e-28 28.9% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  24::181  4.5e-28 34.2% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  24::179  6.3e-28 38.5% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  26::216  2.4e-27 33.9% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  19::208  2.5e-27 34.2% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  17::219  3.2e-27 39.4% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  17::209  4.1e-26 29.6% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  19::189  4.4e-26 37.3% 0047844 00478441 1/1   arboxykinase-like                       
  22::225  7.5e-26 29.7% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
   7::195    2e-25 31.1% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  16::205    2e-25 30.5% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  25::195  5.7e-25 35.1% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
   4::216  2.3e-24 31.4% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  24::168  3.2e-24 37.5% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  22::218  1.1e-23 27.7% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  19::208  2.6e-23 30.9% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  16::119  2.9e-23 40.8% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  25::212  4.5e-23 27.4% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  17::199  3.3e-22 32.6% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   2::187  1.7e-21 31.7% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  25::210  6.5e-21 36.4% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  27::188  8.6e-21 31.4% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  26::212    1e-20 25.6% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
   4::206  1.1e-20 30.7% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
   1::196  1.3e-20 33.1% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  18::174    2e-19 36.4% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   5::218  3.6e-19 35.8% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  20::187  6.1e-19 33.8% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  17::206  9.1e-19 36.2% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  16::168  1.1e-18 33.1% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
   7::207  2.9e-18 35.5% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  25::166  5.2e-17 33.9% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  24::198  6.5e-17 27.5% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  17::217    1e-16 24.4% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  19::186  1.6e-16 42.9% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  19::206    2e-16 26.5% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  12::218  5.1e-16 31.8% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  10::191  6.4e-16 28.8% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  26::190  7.4e-16 26.2% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
   3::219  1.2e-15 30.4% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  17::191  1.9e-15 28.5% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
   1::204  4.4e-15 29.5% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  17::202  7.3e-14 31.6% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
   7::204  8.4e-14 28.1% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  24::165  1.5e-13 32.8% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  21::199  3.2e-13 27.3% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
   4::191  5.1e-13 32.0% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  18::156  1.6e-12 37.2% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  25::169  6.3e-12 28.2% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  22::207  6.6e-12 24.5% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  24::158  8.2e-12 28.2% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  21::195  8.7e-12 27.7% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  25::168  1.1e-11 26.9% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
   3::218  1.4e-11 23.2% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  24::168  1.9e-11 23.4% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  22::221    2e-11 23.3% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  17::191    4e-11 27.7% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  26::157  4.7e-11 31.5% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  24::162  7.3e-11 32.0% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  28::200  2.9e-10 25.2% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  16::74   5.7e-10 39.0% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  18::189  6.2e-10 31.2% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  24::172  7.2e-10 26.5% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  14::188  8.3e-10 29.2% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  20::195  1.2e-09 24.8% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  21::156  4.9e-09 44.4% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  17::191  1.3e-08 26.2% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  21::60   1.6e-08 40.0% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  25::92   1.9e-08 41.3% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  19::196  3.6e-08 23.3% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  13::208  6.7e-08 22.1% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  24::162  2.5e-07 28.7% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  27::166  2.5e-07 22.4% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
   9::59   4.2e-07 36.0% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  24::60   5.2e-07 43.2% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  24::58   1.6e-06 42.9% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
  23::168  1.7e-06 25.0% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
   2::155  3.1e-06 30.3% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
   4::166  3.4e-06 30.7% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  23::196  3.8e-06 19.2% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  10::47   4.3e-06 44.7% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  12::47   6.6e-06 47.2% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
   6::198  8.1e-06 25.8% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  16::166  8.8e-06 25.0% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
  25::92   1.5e-05 22.7% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
   6::92   1.8e-05 30.1% 0049506 00495061 1/1   p containing nucleoside triphosphate hy 
  25::49   2.4e-05 36.0% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  24::49   3.6e-05 38.5% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  24::49   4.7e-05 38.5% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
  16::47   5.1e-05 37.5% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
  24::49   5.7e-05 34.6% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
  25::58   5.7e-05 39.4% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
  11::47   5.9e-05 45.9% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
  13::55   6.1e-05 37.2% 0045376 00453761 1/1   p containing nucleoside triphosphate hy 
  24::47     8e-05 50.0% 0047547 00475471 1/1   p containing nucleoside triphosphate hy 
  23::49    0.0001 46.2% 0046442 00464421 1/1   p containing nucleoside triphosphate hy 
  21::59   0.00012 31.6% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
  24::47   0.00013 41.7% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
   2::57   0.00016 25.0% 0044125 00441251 1/1   p containing nucleoside triphosphate hy 
   2::47   0.00019 40.5% 0049485 00494851 1/1   p containing nucleoside triphosphate hy 
  16::47   0.00019 40.6% 0051448 00514481 1/1   p containing nucleoside triphosphate hy 
  28::155  0.00022 38.5% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
  17::49   0.00026 51.5% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
  23::47   0.00028 40.0% 0048426 00484261 1/1   p containing nucleoside triphosphate hy 
  27::47    0.0003 42.9% 0051784 00517841 1/1   p containing nucleoside triphosphate hy 
  28::59   0.00035 41.9% 0052691 00526911 1/1   p containing nucleoside triphosphate hy 
  26::160  0.00039 24.6% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
  10::47   0.00041 31.6% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
  24::47   0.00043 45.8% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
  25::49   0.00054 37.5% 0047933 00479331 1/1   p containing nucleoside triphosphate hy 
  12::47   0.00056 38.9% 0051582 00515821 1/1   p containing nucleoside triphosphate hy 
  26::49   0.00056 50.0% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
  15::47   0.00061 45.5% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
  23::92   0.00063 27.9% 0050316 00503161 1/1   p containing nucleoside triphosphate hy 
  23::59   0.00064 32.4% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
  26::49   0.00069 41.7% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
  12::47    0.0007 36.1% 0051510 00515101 1/1   p containing nucleoside triphosphate hy 
  13::47   0.00076 34.3% 0052859 00528591 1/1   p containing nucleoside triphosphate hy 
  23::47   0.00079 40.0% 0053196 00531961 1/1   p containing nucleoside triphosphate hy 
  17::47    0.0009 38.7% 0051832 00518321 1/1   p containing nucleoside triphosphate hy 
  24::49   0.00095 37.5% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
  25::156  0.00098 26.1% 0048381 00483811 1/1   p containing nucleoside triphosphate hy 
  15::47   0.00099 39.4% 0051927 00519271 1/1   p containing nucleoside triphosphate hy 
   1::232


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGSLTIDGVDHTTMPPSR
00390411   1/1  -----------------MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsg
00379581   1/1  lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldita
00500441   1/1  lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdi
00378981   1/1  lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllll
00422801   1/1  -llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkll
00475891   1/1  lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00420701   1/1  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldll
00425571   1/1  -lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllalsl
00509431   1/1  Mlelknlslsnfrvlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdlifl
00495371   1/1  ------------------esalellleledltklstgikaLddvlggglpkGeivlllGpsGsGKttlal
00440861   1/1  ---------------MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgs
00482201   1/1  llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00367901   1/1  -lelknlslsygksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilkg
00475991   1/1  -----------------lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGK
00404101   1/1  --elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltalsl
00502741   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00466971   1/1  llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdil
00466931   1/1  -----------------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsG
00482261   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildl
00530591   1/1  -----------------llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpn
00490801   1/1  -llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeivalvG
00510251   1/1  -lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeival
00458601   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditgl
00485451   1/1  ----------------skiygdealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpl
00436071   1/1  pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla..
00361211   1/1  plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlld
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiytgipaldvslglgGlppGeivlllGpsGsGKTtL
00372301   1/1  yvlPllsdgmpllelenlrkpyggllvlndvsl.pgeivaltGpnGaGKSTllrllaglllpasggilvd
00424961   1/1  -----------------lslpigkGervalvGpsGaGKttLlrliaglldpdsgeilldgvdigersrev
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGer
00469451   1/1  allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdv
00500611   1/1  ------------------pgllsllelllelenltklptgipaLddvlgggipkGeivllvGpsGsGKTt
00496111   1/1  ------------------elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllk
00379601   1/1  llelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel....
00488521   1/1  ------lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllpp
00436511   1/1  ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikkGe
00422141   1/1  dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlieliflde
00485931   1/1  -------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi.......
00367481   1/1  yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllpas
00457311   1/1  ----------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyklsr
00503371   1/1  -Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgkdlliyls
00381441   1/1  ------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgevd
00468601   1/1  ----------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaaae
00532531   1/1  -----------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinleggfy
00448931   1/1  --------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla.ar
00495031   1/1  ------------------lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlll
00437981   1/1  lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkd
00493431   1/1  -----------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpgev
00464791   1/1  lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkGer
00475521   1/1  -----------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlvdlepl
00480471   1/1  ------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeilldg
00478411   1/1  -----------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.d
00477971   1/1  ----------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttrpprpgev
00475381   1/1  -----------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavlsrd
00475371   1/1  -------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi.......
00414121   1/1  ----------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgql
00371631   1/1  mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgk
00368501   1/1  ----kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtl
00426051   1/1  ----------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlgges
00496571   1/1  -----------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirgeplg
00462761   1/1  ------------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvl
00464411   1/1  ---------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgeplge
00515531   1/1  -----------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidgvkl
00533501   1/1  -----------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp..l
00487021   1/1  ---------------------rm...kiivltGpsGsGKsTlarlLaell....gvvvidtddllra...
00510561   1/1  ---------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDlll
00484101   1/1  -----------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrldlde
00515511   1/1  -----------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgvkl
00512891   1/1  -------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv...rsar
00379961   1/1  ------------------slalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdlldp
00437941   1/1  ----------------alslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidaselld
00490731   1/1  ----------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp.......
00478441   1/1  ------------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.
00468951   1/1  ---------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLD
00368571   1/1  ------llgvrllpplppklagllplagladgdglgvllGklldgvpvtldlgel.grhllivGptGsGK
00434401   1/1  ---------------MlsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvav
00532471   1/1  ------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelg
00503741   1/1  ---fifldlrplallplpdrlvgrdeeiealskalggaldgvslsiepggivllvGppGvGKTtLaklla
00499191   1/1  -----------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd............g
00498531   1/1  ---------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDall
00470731   1/1  ------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlaral
00387201   1/1  ---------------mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralag
00498811   1/1  ------------------------kPgkiigltGpsGsGKsTlarlLae.l....gvividgddltrelv
00379261   1/1  ----------------alsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkllgapfv
00356411   1/1  -lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvkltl
00405881   1/1  ------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgvveld
00477011   1/1  --------------------------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnal
00480441   1/1  -------------------------rlivllGpsGaGKsTlaklLaell.p..glivisv.gdttrepre
00406781   1/1  ---llealaglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase..........
00392701   1/1  keallealagarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd..........
00508671   1/1  -----------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvll
00489571   1/1  ----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt..............
00451571   1/1  -------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl.....lr
00404191   1/1  ----------------llslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa.........
00533151   1/1  ---------------M..sldikkgklivltGppGsGKtTlarlLaerl....glpfist.ddllrelvp
00420941   1/1  ------lalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel..gapfiridg..........
00515351   1/1  ------------------------mngklivltGppGsGKtTlaraLaerlglpvistddllreav....
00489631   1/1  -----------------------MkgklillvGppGsGKtTlaraLaellglpf..iridgddllrellg
00480251   1/1  ----------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyr....
00432181   1/1  ------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvvel
00499331   1/1  ------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddllrepvi
00513251   1/1  -----------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr......
00437901   1/1  ---------slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGpp
00513761   1/1  -------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDparanlpe
00444381   1/1  --asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrllellgarpg
00394721   1/1  ----------------allealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpv.....
00402371   1/1  vlektgipltkllrpvllddviGqeealeallealrrrpgrnvllvGppGvGKTtlaralagllvrssgp
00386741   1/1  ----------------avllgirpgehllLvGppGtGKTtlaralagelga...................
00367291   1/1  ------lelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel..gapfirvda..........
00476071   1/1  -----------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll.ggpl
00472911   1/1  --------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageggk
00521551   1/1  ---llealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagll..........gapfvrlsas.
00517691   1/1  -----------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg..........
00478081   1/1  ------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrreair
00439861   1/1  ---------------------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaan
00461621   1/1  -----------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddlyrevv..erg
00478391   1/1  --------------------msikkgklilltGppGsGKtTlaralaerl....glpvidgddllrelvg
00496061   1/1  ------------------------gklivltGppGsGKtTlaklLaerlglpvistddllre.....eve
00416171   1/1  --diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalte....
00457851   1/1  -----------------------PkgklivltGppGsGKtTlakaLaerl....glpvist.ddllreav
00482551   1/1  ---------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaal
00437921   1/1  ----------------rlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldasdlrg
00469161   1/1  -------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtplge
00482721   1/1  -----------------------kgkiigltGpsGsGKsTlarlLae.l....glpvidtddlyrelvag
00527261   1/1  ---------------------------npfilgpkvdledfigreeelkeleealpkivlltGprGsGKT
00495771   1/1  ---------------ldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrhtTrdv
00409841   1/1  -----------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv...
00487061   1/1  -----------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdyw
00430121   1/1  -------------iPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkglelgirpggnvl
00489391   1/1  -------------------lsikkgklivltGppGsGKtTlakaLaerl....glpvistddllreavpg
00401211   1/1  --------------------elkrglnvgivGhvgaGKSTLlnaLlgll.....................
00473941   1/1  ----------------alllalalallrgepgehvlLvGppGtGKTtlaralagllga............
00420081   1/1  --------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvg----------
00493171   1/1  ------------------------mgklivllGpsGaGKsTlaklLaekl.....glivlsvgdttrepr
00511381   1/1  ------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtrlgie
00410531   1/1  ------------gelknlslelkkglkillvGlngvGKTtllkrlag.......................
00519581   1/1  -----------------------kpkvilltGppGvGKttlarlLakll.glpliidldalaellfgdvg
00509891   1/1  --------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrld.
00410321   1/1  --------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp.eygptig-----------
00478131   1/1  -----------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvid----------
00403151   1/1  -----------------------kglkivlvGdsgvGKTtLlnrllgdefpvsyipti------------
00457881   1/1  ----------------------m.gklivltGppGsGKtTlaklLaerlglpvidtddl......lrele
00497571   1/1  -aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkylpsllslldvlrpkvdfdd
00482661   1/1  ---kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksnr
00477561   1/1  ----------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrr....
00378621   1/1  ---------glklllrrlslllkkglkvllvGlpgvGKstllnrlag-----------------------
00471271   1/1  -----------prailelesliksllekllellkrlslklkkglkva-----------------------
00418301   1/1  -----drplleklrpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtl
00480501   1/1  ---------------M........gklillvGppGsGKtTlaralaell.g..gvvvid.gddlrralvg
00516041   1/1  ------------------------mlkgklillvGppGsGKtTlaralaeelglpfvvidaddl..lrge
00495061   1/1  -----dlgllliyeevllydvvprgrlivlsGPsGaGKs.llklLadklglsvshttrpprpgevdgvdy
00477721   1/1  ------------------------kpklilltGppGsGKttlaraLaee---------------------
00512061   1/1  -----------------------kkkkgklivltGppGsGKtTlakaLa---------------------
00491901   1/1  -----------------------lmkgkiilltGppGsGKttlakaLae---------------------
00414001   1/1  ---------------rrlllelkmllrvgivGlpNvGKSTLfnaLtg-----------------------
00493981   1/1  -----------------------kpklilltGppGsGKttlaraLaeel---------------------
00523461   1/1  ------------------------a.kvalvGlpnvGKStLlnallgdkaivsdipgi------------
00488191   1/1  ----------fllsllrrlslllkrllkvalvGlpgvGKStLlnall-----------------------
00453761   1/1  ------------vwvpdeeeglvlalvlsdgslllvkldlllllnplkllgveDl---------------
00475471   1/1  -----------------------mglkvalvGlPNVGKSTLlNaLtg-----------------------
00464421   1/1  ----------------------MkkgkfIvieGpdGsGKTTlaklLae.---------------------
00444821   1/1  --------------------elkkllkvllvGlpgvGKttllnrllggefai.ygptig-----------
00447401   1/1  -----------------------kelkivlvGdsgvGKttLlnrllg-----------------------
00441251   1/1  -remsmsewilerldklledidwnpivkllkyqgvefigflealknilkgipkkncl-------------
00494851   1/1  -ldllglelllslldr.llllkkkllkvalvGlpgvGKStLlnallg-----------------------
00514481   1/1  ---------------alllslllkkllkvalvGlpnvGKstllnrll-----------------------
00462581   1/1  ---------------------------edleslllnplvkfedivpkvlddleealealaeaklpppkgv
00372481   1/1  ----------------dlslllkrirnvaivGhvdaGKsTLlnaLlgal---------------------
00484261   1/1  ----------------------kkllkialvGhpnvGKStLlnrltg-----------------------
00517841   1/1  --------------------------hgegirdlldlidelrdller-----------------------
00526911   1/1  ---------------------------rkvalvGlpnvGKStLlnrllgakvse.pgtT-----------
00486921   1/1  -------------------------mlivltGppGsGKtTlakaLaerl.....glpfistddllreavp
00387321   1/1  ---------glkglllrlklelkkllkillvGlpgvGKTtllnrllg-----------------------
00378841   1/1  -----------------------kelkillvGdsgvGKstLlnrllg-----------------------
00479331   1/1  ------------------------apkli.ltGppGsGKttlakaLaee---------------------
00515821   1/1  -----------glllllllslelkkllkvalvGlpnvGKstLlnrll-----------------------
00518511   1/1  -------------------------klIvleGpsGsGKsTlaklLaekl---------------------
00424711   1/1  --------------llrlslllkkglkvalvGlpnvGKSTLlnaLlg-----------------------
00503161   1/1  ----------------------pkgrpivLiGpsgsGKs.ladlladrlglpvphttrppregevdgvdy
00470231   1/1  ----------------------elaellsllierlllrdlllelkllkvllvGdpnvGK-----------
00515801   1/1  -------------------------llIvltGppGsGKtTlaklLaerl---------------------
00515101   1/1  -----------pleelllslllkkllkvalvGlpnvGKstllnrllg-----------------------
00528591   1/1  ------------sallllllelkkllkvalvGlpnvGKstLlnrllg-----------------------
00531961   1/1  ----------------------kkllkvvlvGdpnvGKstLlnrllg-----------------------
00518321   1/1  ----------------msslelkkllkvvlvGdpnvGKstLlnrllg-----------------------
00501941   1/1  -----------------------kl..illtGppGsGKttlaralaeel---------------------
00483811   1/1  ------------------------PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldldellrgllg
00519271   1/1  --------------sllsslllkkllkvalvGlpnvGKstllnrllg-----------------------


                         -         -         *         -         -         -         -:140
query           RPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQGKMHAIARQMGIDNLMARLPGELSGGQRQRVAL
00390411   1/1  lrvgklsdlirrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldl
00379581   1/1  lslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellelvgl
00500441   1/1  ldlsllrrgigyvfqdpalfpgltvlenlllgllllglslaeaaeralelllllgledlldrlvseLSgG
00378981   1/1  slaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellellglddlldrlvgeL
00422801   1/1  agllkptsGeilldgldilalslaelrrrigyvfqdpalfp.ltvrenlalglllallllglskaearar
00475891   1/1  lglsllellrrgigyvfqdpalfpgltvlenlllgllllglalkeaalralllllllgletlldrlvseL
00420701   1/1  llslaellalrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellellglddlldrlvge
00425571   1/1  lrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellellglddlldrlvgeLSgGqrqrv
00509431   1/1  gslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrrligyvpqd
00495371   1/1  rllagllkp...evlvdgldltglsparggiglvfqteallppltvrenlealgldlrglld...rervi
00440861   1/1  llnvalvGpsGsGKStLlnaLlgllkpdegvilvggk.gvTrdivlytledgvkltliDtpGlgdtklsd
00482201   1/1  slkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlpseL
00367901   1/1  llllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpalfpqlt
00475991   1/1  STllkllagllkptsGeilldgkdildlslaelrgigyvfqqdallpsltvlenlllglllagellllll
00404101   1/1  aelrrgigyvfqdpalfpgltvrenlalgll.....kaeararalellellgldelldrlvgeLSgGqrq
00502741   1/1  slaelrgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellellgledlldrlpseLSgGqr
00466971   1/1  glslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgletlld
00466931   1/1  eilldgkdilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlellllllll
00482261   1/1  slaelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldrlpse
00530591   1/1  GsGKSTllkllagllkptsGeilldgkditdlslkelrgigyvvqqdallpsltvlenlllgllllglll
00490801   1/1  pnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..........ll
00510251   1/1  vGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..........
00458601   1/1  spqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllllgl
00485451   1/1  lltggkvlvigldifrlsarelrkrigvfqdpallphltvpenldlglll......eilervlellelvg
00436071   1/1  .lrrgigyvfqdpalfpgltvlenlalgllllgll..ealaralellellglgdl.drlvseLSgGqrqr
00361211   1/1  gleisalslaerlragigyvfqdlalfpeltvlenlalg.............rarellerlglail.drl
00498251   1/1  alrllagllkpgggvvyidgeesldll.rarrlgvvlqelllfpeltveenl..................
00372301   1/1  gedlr........igyvfq..................................llervgledlldrlpst
00424961   1/1  telleelrrviglvfqdpplfprltvaenialgaeyfrdegadvllladsllrlagalrevlgrlgrelS
00468691   1/1  vglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelrelrrrigyvfqdpalfpeltvlenlalgal
00469451   1/1  lylsleesleqlrrrigyvfqdpalfp.........................aeellelvgledlldrlp
00500611   1/1  lllqlagllapdsgeillggkvlyisleeslrrrrigmvfqelgldpdltv.................ar
00496111   1/1  ptggkvliiglelsaeelrerrrrigyvfqepalfpeltvlenlalgll.....................
00379601   1/1  lrnkigyvfQdpvlfp.ltvren...............................................
00488521   1/1  dsGei.............ggkvlyvdqeeslfp.ltvlenlalg...........gedveellerlgl.d
00436511   1/1  rvglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpalpa
00422141   1/1  eellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlgl
00485931   1/1  rrigavpqlpvlfprltvlenlalg.......gadlaeraeellellglegfdvvliDtagrgrrvgels
00367481   1/1  ggilvpgedalll..........................................rvdeiltrvglsdll
00457311   1/1  eelrklrrrigmvfqdpalflnpgltvrenlaeplrll.klgkk.......llepvglpevldryphels
00503371   1/1  dlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslkeliellldls
00381441   1/1  gvdltfls..reeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeellellgld
00468601   1/1  rlgigavpqdvplfpsltvldnlalar...dlleaakaagydvvlidtaglld.ldrlvgelsggqkqrv
00532531   1/1  akaigllrrkigyvfq...lfpfltvlenvalgld..glvdeedleraenllalvgleeipnrypselsg
00448931   1/1  eqlgivfqdp....gltvlenlalg.........eleararellellgledydvvliDtagrlrlpsels
00495031   1/1  qlagllalglgliplggkvlyiglelt.lsperlrlraqsl....................gldldell.
00437981   1/1  i......rrgiglvfqliglfphltvlelvalgl......ggilveevrellkel............lsg
00493431   1/1  rgigyvfqsgalfphlivagnlleg....aevhgllygtskerveealekgllvlldrdlsggqqlrval
00464791   1/1  vglvGpnGaGKTtLlkllagllkpdsgeivvygligerprevrellglllelgvlf..............
00475521   1/1  rrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrlp...sggqqq
00480471   1/1  kdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpvilll
00478411   1/1  lvrlglkd.gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvglddlldrypdels
00477971   1/1  dgvgyvfqsrelfpeltvagnflegaevrgnlygtsrerveellea.gldvlldidpqglsggqkqrlal
00475381   1/1  llgllreglirigyvfqdyalfprltvlenvllgll........................llgglvvild
00475371   1/1  .............................rrpsarel..lgllgellgldvlvgarggdlsgglrqr..l
00414121   1/1  ledlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlilid......................
00371631   1/1  lalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeqlkrigllfqk
00368501   1/1  aralakllga..pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvlenlalgllvs
00426051   1/1  glllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprvielllegldt
00496571   1/1  elirglvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvglsdlaygfprtlsglgqrqr
00462761   1/1  ldgddlr....lglliglvfqdpdllpfltvlenvllpllaagliv.....ivdgtlllvglrealrkll
00464411   1/1  l.igevfqdgilfpdltvlenvalgrygllglikealaegviv.ildrvglsdla..ypgflsggeqqrv
00515531   1/1  qlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenl.anvpil
00533501   1/1  grgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlaydgfprlls
00487021   1/1  ....gevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgl..lldrippalsgGqgq
00510561   1/1  giGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleqlrarrlgldldrlllldalt
00484101   1/1  llgigylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelalplilelr
00515511   1/1  qlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpill
00512891   1/1  rgigyvfq........tveellgllaelvgle............vrgeleellktlikelsggekqrval
00379961   1/1  kdlrellragiplvflnfaalpasllesel.....................................lsg
00437941   1/1  ..........................................................pselsggerqrv
00490731   1/1  .............................yrpaadel..lgvlaeelgldvllgarggdlsgglrqr..l
00478441   1/1  dlvllelrgrdilmvfqppalfpllevrglniaevlela.glskaealkrvdlvlelvgld...drypye
00468951   1/1  lllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyid.teesldqlrarrlgldlddllll
00368571   1/1  StllrllaglllpdggrviviDpkgeyaglarglgvvildpg.dgrsvrlnplaliddeedaaellralv
00434401   1/1  idlddfyrpaaelllreglgidfqlpdal......................drellreevlellglgevv
00532471   1/1  gaalldivdegrliglvfqdldllpllevlellaa.......................rleellerippa
00503741   1/1  gllkpkfgeillfg......kvvyvnvselldlkellrll..............................
00499191   1/1  llvgvvfqddfylllpalevlengaflldlllpdaldrelllelllalveglvvlldryprllsggqrqr
00498531   1/1  giGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleqlrarrlgldldellllpalt
00470731   1/1  akel..gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidall.........rkgpd
00387201   1/1  llgptsfvvsptftlvreyelGeilldgrdlyrlsleeallllfldeil---------------------
00498811   1/1  aggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldllgldvvilegpll
00379261   1/1  evdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrligappgyvgyglgg
00356411   1/1  wDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi.ilv
00405881   1/1  d......................................grqlvlvDtpGlielaslgeglvrqaleale
00477011   1/1  lGldvlpvgggpgtrrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpia
00480441   1/1  gevlgvdyvfvdrelfeelivagnlledaivhgllygtskerieealda.glgvlldgfprglsqaqalr
00406781   1/1  ...................................................llgkyvgelsgglrqrlal
00392701   1/1  ...................................................llgkyvgelsgglrqr..l
00508671   1/1  dgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgl.elrdelrellkeaglpllv
00489571   1/1  ...................................................................lal
00451571   1/1  eaiglvtqdgelllelid.egilvpdeiv...........iellrealeeldadgvildgfprllgqael
00404191   1/1  .....................................................delvsklsgglqeqrva
00533151   1/1  ggldigevfqda.leaglllfddefrglller..................leellargpvvildgfpggl
00420941   1/1  .................................................sellgkyvgelsgglrqllal
00515351   1/1  ..pggtdigelfqdyllfpfltvdeni..............rglllealeellaag.kvvildglsggll
00489631   1/1  ellgrgigfgfqqgdlledatvlenlalllldeidka....................ledggvvlldgfd
00480251   1/1  .............psapeqlgi..lgellgvpvvgvltgldlagalrealell..llegydvvliDtagg
00432181   1/1  dgrkl..........................................................vliDtpG
00499331   1/1  gagtdigevfqdlllaggllvddev..................rrlllealdelllaggkvvildgfpgg
00513251   1/1  ..............................................................gqkqrval
00437901   1/1  GvGKTtlakalakel..gapvieidaselrd.......................................
00513761   1/1  qlgi...dirdlidletvme.lglgpngalvfaleellttldillealelleedydyiliDtpGglelra
00444381   1/1  envlLvGppGtGKTtlakalakll..gvpfiridgselte.........kelvGe...............
00394721   1/1  ..............................................vrldlsellsvsdlvgelegglrg
00402371   1/1  illdgvpfvrldaselle.................................................fgk
00386741   1/1  ..................................................pfvrldaselsggeklrgll
00367291   1/1  .................................................selleklvg..egegrlrgal
00476071   1/1  lerirellgegyllfdealdrellaallfglelegal........................ldglvygvl
00472911   1/1  pl.....................................................gllfedaleagfrqr
00521551   1/1  ..................................................elvgkyvgelegglrqllal
00517691   1/1  ...................................gtlllllgllsfllalvldslplerergitidval
00478081   1/1  elllgldlleilf..........................................eglllsdefrellee
00439861   1/1  laknggkvlyisleesreqlleraerlgldleellllgllsiliad........................
00461621   1/1  telgklikdyfdpgalvpdllirlllerllfldegg...gflldgfprtleqaeals.....kpavlsgg
00478391   1/1  eggrlgrdlfdedrllfrellideidl...........................................
00496061   1/1  pggtdlgeifqalllagel.lfddevlgll......rerldelielllagg.vvildgfpldlegalllr
00416171   1/1  .............................................dlleselfghekgafgggekqrlgl
00457851   1/1  pggtrlgeviqdlfllggllffdeldel...........lkerieellaag.gvildgfpldlegaealr
00482551   1/1  plelgklggkvlyisteeafsperlreralslgldleelldrllvidat.....................
00437921   1/1  vddlreligevlqalglllgg.................................................
00469161   1/1  lirelllegfqdlilvpdllvlellaan.......raglrelikellaa.gkgvildrfplsrlayqlsg
00482721   1/1  gtplgerirellgegyllpdea.........lfrallaellfgdllalalldgvvydrlrdellaelsgg
00527261   1/1  tllkalakel..gkpviyidlselsskgyvdleellrelaeelg...................ellellk
00495771   1/1  llir------------------------------------------------------------------
00409841   1/1  ......................................................................
00487061   1/1  aavgggdllrlirelllrlgfgepdafdnellgellealleg............................
00430121   1/1  lvGPpGvGKTtlakalagllfp.......sgvpfirinlseltekllvselig.................
00489391   1/1  gtdlgelfqdlllegellfideiaelllealae.....................................
00401211   1/1  ....................................................ldtlkgelergitikiga
00473941   1/1  .................................................pfielsasdllg..esdlrgg
00420081   1/1  ----------------------------------------------------------------------
00493171   1/1  egevdgvdyvfvsgelfkelid------------------------------------------------
00511381   1/1  lvvsriglvleavglffaldllelll............................................
00410531   1/1  .....................................gefvdygptigvnfktvevdgvklviwDtaGqe
00519581   1/1  glvvdli...................................................dleaverhlldi
00509891   1/1  ...........................ldeplgvdr.erlrrvgelalllaggglcalvaddlagaleel
00410321   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00457881   1/1  pdgtelgellqdlllaggl.lpdaivrdlllelleelladgkgvild..........gfprdleqaealr
00497571   1/1  iileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgrl.pfirvn.
00482661   1/1  qkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvgqeeakeallenlk
00477561   1/1  ................................alifqd.eldlfdedree..gfrvpeelvrellkel.l
00378621   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00418301   1/1  aralakllgr............................................................
00480501   1/1  gl...........................................idgllilfledeaalselvlevlle
00516041   1/1  elgriielfdearelvpelall------------------------------------------------
00495061   1/1  hfvsreefe.dl..dagefley------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00441251   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00462581   1/1  llyGppGtGKTtlaralakel..........glpfvrinasd............................
00372481   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00486921   1/1  ggtdlgelfqelllegellfrdell.........dllle..vieellaag.gvildgfplslegaqalra
00387321   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00503161   1/1  hfvsreefee.iqagklleyge------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00483811   1/1  qpk............................................lydlleellellldegekipvel
00519271   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAW
00390411   1/1  relllnllrrrgiglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlk
00379581   1/1  dtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelake.gltvllvthd
00500441   1/1  qrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrladrilvl
00378981   1/1  SgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladri
00422801   1/1  alellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelak
00475891   1/1  SgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelake.gltvllvthdldealrladri
00420701   1/1  LSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladr
00425571   1/1  alarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilvlddGri
00509431   1/1  pnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeeleligplldgl
00495371   1/1  ellelvgleelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelg
00440861   1/1  eeklilkyleeadlvllviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglk
00482201   1/1  SgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak..gltvllvthdlsea.rladri
00367901   1/1  vlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeellellg
00475991   1/1  aakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellel
00404101   1/1  rvalarallllleelsldpdllllDEPtsglDpetraellellrelake.gltvllvthdldealrladr
00502741   1/1  qrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllvthdldealrladrilvldd
00466971   1/1  rlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelake.gltvllvthdldeal
00466931   1/1  lellallldlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllgl
00482261   1/1  LSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak..gltvllvthdlseal.ladr
00530591   1/1  lllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetrael
00490801   1/1  laakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetraelle
00510251   1/1  lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetrael
00458601   1/1  edlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllvtHd
00485451   1/1  ldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiil
00436071   1/1  valarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladriv------
00361211   1/1  pgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvthd
00498251   1/1  .............drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllrlak
00372301   1/1  lsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaalladr
00424961   1/1  gGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDeptsalDgeivlslllalkrlyP
00468691   1/1  lag................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgldalre..
00469451   1/1  gelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH....
00500611   1/1  erviellelvgllelldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkr
00496111   1/1  .....drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrl.kelg
00379601   1/1  .laralrqdPdilllDEptsaldaellqallt.........ghtvvlvthhlntaldladriivlddGri
00488521   1/1  lldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlak
00436511   1/1  llrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdl-----------
00422141   1/1  sygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp..........ieyvf
00485931   1/1  ggqkqrvaiarallllldpelllldEptsglda..lrlllellkel....gltvlvvthddgtakggaal
00367481   1/1  drgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtHdlel
00457311   1/1  gGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrdlgeagrsa
00503371   1/1  ggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellkelekrlelleke
00381441   1/1  adlviilpasleellerldrrggelsggqkqRvala----------------------------------
00468601   1/1  aiarala.apevllldeptsgldalae..llelleel....gltvlvvtKlDgtakgghdlslalrladr
00532531   1/1  Gqqqrv...........illldEPtsgLdpvsr............................leladriyv
00448931   1/1  ggqkqrvaiaralaaplppevllldeptsglda..lrellellrel....gltvlvvthlDllakggadl
00495031   1/1  erllvidllelvgllelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkr
00437981   1/1  GqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak..gvtvilathdlsellpallsrcq
00493431   1/1  aralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleealeelldiivv
00464791   1/1  ...........aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEptsgldal.
00475521   1/1  eilrvaiallilpvllgralallpelllldeptsaldp--------------------------------
00480471   1/1  nkidllddrllrraeaeerie-------------------------------------------------
00478411   1/1  ggqrqrvaiaralalepelllldeptsaldplavvellelllglneeldiila-----------------
00477971   1/1  aralilppsllrgldep.ealdarle.raleellelae..gfdvvivnhdleealelldril--------
00475381   1/1  ggvrqrlalarallldpdvllldep---------------------------------------------
00475371   1/1  arallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadrilvldlgg
00414121   1/1  ..sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDllse
00371631   1/1  g.lpealdveellellldl.ke...................gledilvpvlsggqkqrlalaralvedpd
00368501   1/1  eligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgel
00426051   1/1  laggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellellerl--
00496571   1/1  valarallkpdlvifldeppteeldeRlrkrl.........rlgdteevlehrleraeeladrlialyeg
00462761   1/1  gllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdls.i
00464411   1/1  aiarallpkpdlvllldepteeldeRllkRg.....rllekleyikkrlehylelaepykddv-------
00515531   1/1  lvlnKiDlleakeraeellellglgdlldklpselsgGqkqr----------------------------
00533501   1/1  gggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelrelds.eevlekrlehylelle------
00487021   1/1  rvildrallselayqpdvllldeplsgldaklreelrdllrellpe.gilpdlvifldadpeell...eR
00510561   1/1  v...............................eellalaerllsggkvdlvviDsltalapalelsllld
00484101   1/1  elsdgqiqrvaparallrdpllllldedtvvldkvdlasil-----------------------------
00515511   1/1  vlnKiDlleaklvllllvglfdlldglpselsggqkqrv-------------------------------
00512891   1/1  arallakpdvlllDEid.gldpdvleallelleel.krsgvtvilttndldel.eladriallrrgrive
00379961   1/1  gerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlllpagv--
00437941   1/1  liaralladpkvlllDEi.daldpeaqnaLlklleel..pkgvtvilttnrleeldpallsRfdviefpp
00490731   1/1  arallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadrilvlleglgv-
00478441   1/1  lsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkllgi---------------------
00468951   1/1  paltveellala...............................erllsggkpqlvviDsltalrpallll
00368571   1/1  semgrgeddfftpaarallralilalaeepeptldellellselglrdladrlek---------------
00434401   1/1  ivdvydlsggerqr...aralasgpdvlilDgptlgldv.............lldlpdlvifvdh-----
00532471   1/1  lsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlp---------------
00503741   1/1  ..lealglpppyqlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlrlleegkltd
00499191   1/1  vaia.....dpdvlildgptllldpelr------------------------------------------
00498531   1/1  veellala...............................erllsggkpdlvviDsltalapslllldepg
00470731   1/1  vildgagrtpeqlealldlleelgrpvvviilttnrevlldral.rRpgrllldep..eldppdreer--
00387201   1/1  ----------------------------------------------------------------------
00498811   1/1  lsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividnd.lsleevvd
00379261   1/1  llteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllelldd..-----------
00356411   1/1  lNKiDlleekiveellellgleykgdrdpeelsggqkqrvalarala-----------------------
00405881   1/1  radvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDep....tneldlellellee
00477011   1/1  .......gisrdairleielpglpdltlvDtPGlgsvavvdqlsggqk----------------------
00480441   1/1  laldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddleealelllai
00406781   1/1  ara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattndleel----
00392701   1/1  arallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtv--------------
00508671   1/1  vfldaplevlleRdrrglypeelsgglkqrvaia------------------------------------
00489571   1/1  lelrntteagaasgsrdkgllgklkpetraelldllre....egttilvvth.ldeaer.aDrvavldd.
00451571   1/1  llsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiar-----------------------
00404191   1/1  iafalarkpdllllDEidalgldpelqeellelldelaer.gvtlilttnnrpeeldqallrllsr----
00533151   1/1  lqrealrrlllrpdlvifldapleelle------------------------------------------
00420941   1/1  ara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnvtviattnrpeeld---
00515351   1/1  qrvallrallrpdlvifldapleell--------------------------------------------
00489631   1/1  rsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryr------------
00480251   1/1  lqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaalsval
00432181   1/1  leefasggekqrvalalallreadvlllvvdadeptsfldlellel------------------------
00499331   1/1  llqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryeeltrdliely----
00513251   1/1  leaalkegylvvvDet..gldraqrlellelardlgrpv.lviflatspevlierlldrvllldegslvd
00437901   1/1  ...............vddlsgyvgelsggeklrellaealteavlkgkpsv-------------------
00513761   1/1  llalllaiaralaadeillvddptsgldaetqleilelllelllklgipi--------------------
00444381   1/1  ...............................segailsggfkqrvgia..lladpgilflDEidkllddr
00394721   1/1  llteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlvi-------------------
00402371   1/1  yvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg....nv------
00386741   1/1  arala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldglllpsgvlviat--------
00367291   1/1  aealradpgvlflDEidalagkrgsgtsrldpevqnaLlrlleelrvlsgvlviattnrpeeld------
00476071   1/1  qdrllerllaagpdvlildgpl.ll---------------------------------------------
00472911   1/1  ladlirallakgkvvild..gtglsreareellellkelg...pvlvifldadpevlle-----------
00521551   1/1  araa..npgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegledl-------------------
00517691   1/1  arllldgrkilllDtP------------------------------------------------------
00478081   1/1  alalladgdvvilDgfgrlldarqlleel-----------------------------------------
00439861   1/1  ..........plglsgeellrvllalalelkpdlliiDeltalld.aervrelrellralkrlakel---
00461621   1/1  rkqrlalaralavdpe.l----------------------------------------------------
00478391   1/1  ......llakgkvvildgtnlsealdealrrllr..........pdlvifldapl---------------
00496061   1/1  ealarallpdl.vifldapleelleRll------------------------------------------
00416171   1/1  lrla..dggvlflDEidkl.dpdvqnaLlrvleegeltrlgggivlpadvrliaatnpdllelvlegelr
00457851   1/1  eallragplpdlvifldapleelleRll------------------------------------------
00482551   1/1  .dlldllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrlLkrlakelgvt
00437921   1/1  ...........kpdvlllDEi.drldpdaqnallklleel..pagvtlilt-------------------
00469161   1/1  gerqrlaidlegallle-----------------------------------------------------
00482721   1/1  qgdvliiegalllepgllplpd------------------------------------------------
00527261   1/1  kllkklsellglsilglelilglsggdleelleelaellkklgkpvililDEiqsll.dv----------
00495771   1/1  ----------------------------------------------------------------------
00409841   1/1  ..vlldgrdllllDtPGlidfaseptnlldleiieallrale....ead---------------------
00487061   1/1  .................gki.vlsarraqlle--------------------------------------
00430121   1/1  .............................hppg.yvGedelgvlfeaa----------------------
00489391   1/1  ......aegkvvildgtg..ldieqrealrelllel..prpdlvifldadpeell---------------
00401211   1/1  asllldklaivsdtpg------------------------------------------------------
00473941   1/1  fkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilgggl-------------------
00420081   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00511381   1/1  ........qdpdviliDE.aqfldpevvevllelad.....tgilvlvtglemdfa--------------
00410531   1/1  rfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDlldalllrevs--
00519581   1/1  aeellengeilildeptvglds------------------------------------------------
00509891   1/1  .laralaggpdviliEgagllplpli--------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00457881   1/1  allaelglppdlvifldaplevlleRll------------------------------------------
00497571   1/1  ...............-------------------------------------------------------
00482661   1/1  lflkgpellldlglpkgrgllLyGPp--------------------------------------------
00477561   1/1  arllaeggdvvilDgt..nltleqrealrrllkelgrpd..lviyldapdeelleR--------------
00378621   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00418301   1/1  .........pfirvdaselteaelvGyesgarlrelfaragigllaladpgvlflDEi------------
00480501   1/1  alegggnpdvvildgtnlleedrell--------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00495061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00441251   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00462581   1/1  ...............-------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00486921   1/1  llrelgldpdlvifldappe--------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00483811   1/1  iiellkdvlvsdpdvi------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QGMTNELLSGKASASALLGITG------------------------------------------------
00390411   1/1  el--------------------------------------------------------------------
00379581   1/1  ldealrladrilvlddGrivelgt----------------------------------------------
00500441   1/1  ddGrivelg-------------------------------------------------------------
00378981   1/1  lvlddGrivelgtpeellen--------------------------------------------------
00422801   1/1  ..gltv----------------------------------------------------------------
00475891   1/1  lvlddGrivelgtpeellenp-------------------------------------------------
00420701   1/1  ilvlddGrivelgtpeellen-------------------------------------------------
00425571   1/1  velgtpeellenpaslytael-------------------------------------------------
00509431   1/1  ellvglnglldrplselSgG--------------------------------------------------
00495371   1/1  vtvllvthdle-----------------------------------------------------------
00440861   1/1  elrrgigyvfqdpnlfp-----------------------------------------------------
00482201   1/1  lvlddGrivelgtpeellenpgll----------------------------------------------
00367901   1/1  lgglld----------------------------------------------------------------
00475991   1/1  lrelake.gltvllvtHdls--------------------------------------------------
00404101   1/1  ilvlddGrive-----------------------------------------------------------
00502741   1/1  Grivelgtp-------------------------------------------------------------
00466971   1/1  rladril---------------------------------------------------------------
00466931   1/1  gdlldr----------------------------------------------------------------
00482261   1/1  ilvlddGri-------------------------------------------------------------
00530591   1/1  lellrelak..gltvllvtHdls-----------------------------------------------
00490801   1/1  llrelake.-------------------------------------------------------------
00510251   1/1  lellrelak-------------------------------------------------------------
00458601   1/1  ldealrladr------------------------------------------------------------
00485451   1/1  vthdlreae..a----------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ldlldsal--------------------------------------------------------------
00498251   1/1  elgvtvllvthdl---------------------------------------------------------
00372301   1/1  vvvlndgrivav----------------------------------------------------------
00424961   1/1  aidvllS---------------------------------------------------------------
00468691   1/1  ilellrellkel----------------------------------------------------------
00469451   1/1  ....Asdr--------------------------------------------------------------
00500611   1/1  lakelgvtvllvt---------------------------------------------------------
00496111   1/1  vt--------------------------------------------------------------------
00379601   1/1  veegtpeel-------------------------------------------------------------
00488521   1/1  elgvtvll--------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00422141   1/1  qspnlfp---------------------------------------------------------------
00485931   1/1  slaleladr-------------------------------------------------------------
00367481   1/1  aalaadri--------------------------------------------------------------
00457311   1/1  drvl...---------------------------------------------------------------
00503371   1/1  leeleelle-------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00468601   1/1  ilvlgvGei-------------------------------------------------------------
00532531   1/1  llsGrives-------------------------------------------------------------
00448931   1/1  slaleladr-------------------------------------------------------------
00495031   1/1  lakelgvtvilvt---------------------------------------------------------
00437981   1/1  virfpplse-------------------------------------------------------------
00493431   1/1  lllglilqpgslle--------------------------------------------------------
00464791   1/1  .r--------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00414121   1/1  lthdlellrel-----------------------------------------------------------
00371631   1/1  vlilD-----------------------------------------------------------------
00368501   1/1  lkalkeaea-------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00496571   1/1  avvvi-----------------------------------------------------------------
00462761   1/1  eevadri---------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00487021   1/1  ..llkR----------------------------------------------------------------
00510561   1/1  eptsglda--------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00512891   1/1  lgplse----------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00437941   1/1  pdeeellei-------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00468951   1/1  deptgellgldvrll-------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00503741   1/1  kllglt----------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00498531   1/1  rvtqglda--------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00498811   1/1  ri--------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00480441   1/1  ll--------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00489571   1/1  .....Gtp--------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00480251   1/1  ilglpil---------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00513251   1/1  lgvledll--------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00444381   1/1  geaegggdv-------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00416171   1/1  paLldRfd--------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00482551   1/1  viltsqltrev-----------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00495061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00441251   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------