[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Escherichia coli str. K-12 substr. MG1655 (ecol0)
Gene : ftsQ
DDBJ      :ftsQ         membrane anchored protein involved in growth of wall at septum
Swiss-Prot:FTSQ_ECOLI   RecName: Full=Cell division protein ftsQ;

Homologs  Archaea  0/68 : Bacteria  286/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:276 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->260 2vh1A PDBj e-118 100.0 %
:RPS:PFM   55->125 PF08478 * POTRA_1 6e-10 42.6 %
:RPS:PFM   129->247 PF03799 * FtsQ 3e-24 48.7 %
:HMM:PFM   129->247 PF03799 * FtsQ 1.8e-36 43.4 113/117  
:HMM:PFM   56->126 PF08478 * POTRA_1 2.7e-22 29.4 68/69  
:HMM:PFM   17->49 PF03186 * CobD_Cbib 0.00057 25.0 32/292  
:BLT:SWISS 1->265 FTSQ_ECOLI e-140 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD PEC GenoBase Abbreviations Back to title page
GT:ID AAC73204.1 GT:GENE ftsQ GT:PRODUCT membrane anchored protein involved in growth of wall at septum GT:DATABASE GIB00009CH01 GT:ORG ecol0 GB:ACCESSION GIB00009CH01 GB:LOCATION 103155..103985 GB:FROM 103155 GB:TO 103985 GB:DIRECTION + GB:GENE ftsQ GB:PRODUCT membrane anchored protein involved in growth of wall at septum GB:FUNCTION phenotype; Cell division GB:NOTE cell division protein; ingrowth of wall at septum; GO_component: GO:0019866 - organelle inner membrane GB:PROTEIN_ID AAC73204.1 GB:DB_XREF GI:1786281 ASAP:ABE-0000329 UniProtKB/Swiss-Prot:P06136 EcoGene:EG10342 GB:GENE:GENE ftsQ LENGTH 276 SQ:AASEQ MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ GT:EXON 1|1-276:0| SW:ID FTSQ_ECOLI SW:DE RecName: Full=Cell division protein ftsQ; SW:GN Name=ftsQ; OrderedLocusNames=b0093, JW0091; SW:KW 3D-structure; Cell cycle; Cell division; Cell inner membrane;Cell membrane; Complete proteome; Membrane; Septation; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->265|FTSQ_ECOLI|e-140|100.0|265/276| GO:SWS:NREP 7 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000917|"GO:barrier septum formation"|Septation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 26->48| SEG 31->48|lltvlttvlvsgwvvlgw| SEG 266->275|qqqnqaqaeq| BL:PDB:NREP 1 BL:PDB:REP 58->260|2vh1A|e-118|100.0|203/203| RP:PFM:NREP 2 RP:PFM:REP 55->125|PF08478|6e-10|42.6|68/69|POTRA_1| RP:PFM:REP 129->247|PF03799|3e-24|48.7|113/116|FtsQ| HM:PFM:NREP 3 HM:PFM:REP 129->247|PF03799|1.8e-36|43.4|113/117|FtsQ| HM:PFM:REP 56->126|PF08478|2.7e-22|29.4|68/69|POTRA_1| HM:PFM:REP 17->49|PF03186|0.00057|25.0|32/292|CobD_Cbib| OP:NHOMO 288 OP:NHOMOORG 287 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111111111---------------------------------------------------------11111211111111111111111111111111--11111------11111111111111111-111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111--11111111111111111111-1111111111111111111111111111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 75.0 SQ:SECSTR #####################################################cccccEEEEEcccccccHHHHHHHHHTTccTTcGGGccHHHHHHHHHHHcTTEEEEEEEEETTTEEEEEEEEccEEEEETTTEEEETTccEEEccGGGTTTccccEEEccTTcHHHHHHHHHHHHHHHHTTTccccEEEEcccccEEEEcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHTTEEEEEEEEEETTEEEEEEEEcc################ DISOP:02AL 1-20, 261-276| PSIPRED cccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccEEccHHHHHHHHHcccccccEEEEcHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEEEEEEEEEcccEEEccccEEEEccccccccccccEEEccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccEEEEEEcccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEcccccHHHHHHHHHHHHHcc //