[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Escherichia coli str. K-12 substr. MG1655 (ecol0)
Gene : tsf
DDBJ      :tsf          protein chain elongation factor EF-Ts
Swiss-Prot:EFTS_SHISS   RecName: Full=Elongation factor Ts;         Short=EF-Ts;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  49/199 : Viruses  0/175   --->[See Alignment]
a.5.2d.43.1
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->283 1efuB PDBj e-144 100.0 %
:RPS:PDB   2->283 1efuB PDBj 9e-53 93.6 %
:RPS:SCOP  2->42 1xb2B1  a.5.2.2 * 1e-14 31.7 %
:RPS:SCOP  61->140 1efuB4  d.43.1.1 * 3e-21 100.0 %
:RPS:SCOP  139->262 1aipC2  d.43.1.1 * 2e-32 41.9 %
:HMM:SCOP  4->54 2cp9A1 a.5.2.2 * 2.6e-18 76.5 %
:HMM:SCOP  56->140 1efuB4 d.43.1.1 * 3.8e-21 40.0 %
:HMM:SCOP  141->283 1efuB2 d.43.1.1 * 7.5e-53 59.4 %
:RPS:PFM   61->262 PF00889 * EF_TS 6e-41 55.0 %
:HMM:PFM   57->263 PF00889 * EF_TS 4.5e-74 51.2 207/221  
:HMM:PFM   4->39 PF00627 * UBA 4.4e-13 37.1 35/37  
:BLT:SWISS 1->283 EFTS_SHISS e-144 100.0 %
:PROS 12->27|PS01126|EF_TS_1
:PROS 75->85|PS01127|EF_TS_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD PEC GenoBase Abbreviations Back to title page
GT:ID AAC73281.1 GT:GENE tsf GT:PRODUCT protein chain elongation factor EF-Ts GT:DATABASE GIB00009CH01 GT:ORG ecol0 GB:ACCESSION GIB00009CH01 GB:LOCATION 190857..191708 GB:FROM 190857 GB:TO 191708 GB:DIRECTION + GB:GENE tsf GB:PRODUCT protein chain elongation factor EF-Ts GB:FUNCTION factor; Proteins - translation and modification GB:NOTE GO_component: GO:0005737 - cytoplasm; GO_process: GO:0006412 - translation GB:PROTEIN_ID AAC73281.1 GB:DB_XREF GI:1786366 ASAP:ABE-0000579 UniProtKB/Swiss-Prot:P0A6P1 EcoGene:EG11033 GB:GENE:GENE tsf LENGTH 283 SQ:AASEQ MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS GT:EXON 1|1-283:0| SW:ID EFTS_SHISS SW:DE RecName: Full=Elongation factor Ts; Short=EF-Ts; SW:GN Name=tsf; OrderedLocusNames=SSON_0182; SW:KW Complete proteome; Cytoplasm; Elongation factor; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->283|EFTS_SHISS|e-144|100.0|283/283| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003746|"GO:translation elongation factor activity"|Elongation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 12->27|PS01126|EF_TS_1|PDOC00867| PROS 75->85|PS01127|EF_TS_2|PDOC00867| SEG 43->60|ksgaikaakkagnvaadg| BL:PDB:NREP 1 BL:PDB:REP 2->283|1efuB|e-144|100.0|282/282| RP:PDB:NREP 1 RP:PDB:REP 2->283|1efuB|9e-53|93.6|282/282| RP:PFM:NREP 1 RP:PFM:REP 61->262|PF00889|6e-41|55.0|202/215|EF_TS| HM:PFM:NREP 2 HM:PFM:REP 57->263|PF00889|4.5e-74|51.2|207/221|EF_TS| HM:PFM:REP 4->39|PF00627|4.4e-13|37.1|35/37|UBA| GO:PFM:NREP 3 GO:PFM GO:0003746|"GO:translation elongation factor activity"|PF00889|IPR014039| GO:PFM GO:0005622|"GO:intracellular"|PF00889|IPR014039| GO:PFM GO:0006414|"GO:translational elongation"|PF00889|IPR014039| RP:SCP:NREP 3 RP:SCP:REP 2->42|1xb2B1|1e-14|31.7|41/56|a.5.2.2| RP:SCP:REP 61->140|1efuB4|3e-21|100.0|80/85|d.43.1.1| RP:SCP:REP 139->262|1aipC2|2e-32|41.9|124/143|d.43.1.1| HM:SCP:REP 4->54|2cp9A1|2.6e-18|76.5|51/0|a.5.2.2|1/1|UBA-like| HM:SCP:REP 56->140|1efuB4|3.8e-21|40.0|85/0|d.43.1.1|1/2|Elongation factor Ts (EF-Ts), dimerisation domain| HM:SCP:REP 141->283|1efuB2|7.5e-53|59.4|143/0|d.43.1.1|1/1|Elongation factor Ts (EF-Ts), dimerisation domain| OP:NHOMO 1010 OP:NHOMOORG 956 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----11-------------------------------------------------------------------------------------------------1----41-----1--11--1-1--1-15--111----1-1---1---1--1----2--1----111---1--1111S222225232-241211-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 100.0 SQ:SECSTR HccccHHHHHHHHHHHcccHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHTTccccEEEEEEEEETTEEEEEEEEEccHHHHTcHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccEEEEEEETTTEEEEEEEEcccHHHHHHHHHHHHHHccccccGGGccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHcTTTcEETTEEEEEHHHHHHTTTcEEEEEEEEETTTTcccccccHHHHHHHHcccc DISOP:02AL 197-210| PSIPRED cccccHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccEEEEEEEcccEEEEEEEEcccHHHHHHHHHHHHHcccccccHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHcccHHccccccHHHHHHHcccEEEEEEEEEEccccccccccHHHHHHHHHccc //