[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Escherichia coli str. K-12 substr. MG1655 (ecol0)
Gene : narI
DDBJ      :narI         nitrate reductase 1, gamma (cytochrome b(NR)) subunit
Swiss-Prot:NARI_ECOLI   RecName: Full=Respiratory nitrate reductase 1 gamma chain;         EC=1.7.99.4;AltName: Full=Nitrate reductase A subunit gamma;AltName: Full=Quinol-nitrate oxidoreductase subunit gamma;AltName: Full=Cytochrome B-NR;

Homologs  Archaea  1/68 : Bacteria  232/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.21.3
:225 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->225 1q16C PDBj e-121 100.0 %
:RPS:SCOP  2->225 1q16C  f.21.3.1 * 1e-84 94.2 %
:HMM:SCOP  1->225 1q16C_ f.21.3.1 * 1.1e-76 42.7 %
:RPS:PFM   43->216 PF02665 * Nitrate_red_gam 2e-30 47.4 %
:HMM:PFM   4->224 PF02665 * Nitrate_red_gam 1.4e-90 51.8 220/223  
:BLT:SWISS 1->225 NARI_ECOLI e-123 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD PEC GenoBase Abbreviations Back to title page
GT:ID AAC74311.1 GT:GENE narI GT:PRODUCT nitrate reductase 1, gamma (cytochrome b(NR)) subunit GT:DATABASE GIB00009CH01 GT:ORG ecol0 GB:ACCESSION GIB00009CH01 GB:LOCATION 1285072..1285749 GB:FROM 1285072 GB:TO 1285749 GB:DIRECTION + GB:GENE narI GB:PRODUCT nitrate reductase 1, gamma (cytochrome b(NR)) subunit GB:FUNCTION enzyme; Energy metabolism, carbon: Anaerobic respiration GB:NOTE nitrate reductase 1, cytochrome b(NR), gamma subunit; GO_component: GO:0009274 - peptidoglycan-based cell wall; GO_component: GO:0019866 - organelle inner membrane; GO_function: GO:0009054 - electron acceptor activity; GO_process: GO:0009061 - anaerobic respiration; GO_process: GO:0017004 - cytochrome complex assembly GB:PROTEIN_ID AAC74311.1 GB:DB_XREF GI:1787480 ASAP:ABE-0004125 UniProtKB/Swiss-Prot:P11350 EcoGene:EG10640 GB:GENE:GENE narI LENGTH 225 SQ:AASEQ MQFLNMFFFDIYPYIAGAVFLIGSWLRYDYGQYTWRAASSQMLDRKGMNLASNLFHIGILGIFVGHFFGMLTPHWMYEAWLPIEVKQKMAMFAGGASGVLCLIGGVLLLKRRLFSPRVRATTTGADILILSLLVIQCALGLLTIPFSAQHMDGSEMMKLVGWAQSVVTFHGGASQHLDGVAFIFRLHLVLGMTLFLLFPFSRLIHIWSVPVEYLTRKYQLVRARH GT:EXON 1|1-225:0| SW:ID NARI_ECOLI SW:DE RecName: Full=Respiratory nitrate reductase 1 gamma chain; EC=1.7.99.4;AltName: Full=Nitrate reductase A subunit gamma;AltName: Full=Quinol-nitrate oxidoreductase subunit gamma;AltName: Full=Cytochrome B-NR; SW:GN Name=narI; Synonyms=chlI; OrderedLocusNames=b1227, JW1218; SW:KW 3D-structure; Cell inner membrane; Cell membrane; Complete proteome;Direct protein sequencing; Electron transport; Formylation; Heme;Iron; Membrane; Metal-binding; Nitrate assimilation; Oxidoreductase;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->225|NARI_ECOLI|e-123|100.0|225/225| GO:SWS:NREP 10 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0042128|"GO:nitrate assimilation"|Nitrate assimilation| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 5 TM:REGION 4->26| TM:REGION 49->71| TM:REGION 89->109| TM:REGION 125->147| TM:REGION 184->206| SEG 98->109|gvlcliggvlll| BL:PDB:NREP 1 BL:PDB:REP 2->225|1q16C|e-121|100.0|223/223| RP:PFM:NREP 1 RP:PFM:REP 43->216|PF02665|2e-30|47.4|173/183|Nitrate_red_gam| HM:PFM:NREP 1 HM:PFM:REP 4->224|PF02665|1.4e-90|51.8|220/223|Nitrate_red_gam| GO:PFM:NREP 3 GO:PFM GO:0008940|"GO:nitrate reductase activity"|PF02665|IPR003816| GO:PFM GO:0009325|"GO:nitrate reductase complex"|PF02665|IPR003816| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02665|IPR003816| RP:SCP:NREP 1 RP:SCP:REP 2->225|1q16C|1e-84|94.2|223/224|f.21.3.1| HM:SCP:REP 1->225|1q16C_|1.1e-76|42.7|225/225|f.21.3.1|1/1|Respiratory nitrate reductase 1 gamma chain| OP:NHOMO 301 OP:NHOMOORG 233 OP:PATTERN ----------1--------------------------------------------------------- ----1-11-------1122-21---122222-11111---1----11-1-----1-----21111-1-1----------------------------------------------------------------------------------------------------------------------------1111111-111111111-11-1111112------------1111111111111111111--------1---11-1----------------------------------------------------------------------------------------1-------------------1--1------1----11-----11111111111---1--1-1----------------1--11--1----1----------1----------------------------------------------21----11111111-1222212-1-1121--121-11111111--1--1---1-----------1----1----------------1------------------------------------------11-------------2-11------11----1--------211112-2222222222-222222222222222222122211--1212222222222212211121112-----------------1----------111-----------------------1-1--1111---------1---------------------------11-------------1--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 99.1 SQ:SECSTR #HHHHHHHHHTHHHHHHHHHHHHHHHHHHHcGGGccccccTTTccTTHHHHHHHHHHHHHHHHHHHHHHHHccTTc#cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHGGGTTcHHHHHHHHHHHHHHTTcccGGGGGTTccHHHHHHHHHHHHHHHHGGGcGGGGGGGccGGGGGcccccccccc PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHEEcccHHHHHccccHHHHHHHHHHHHHHHHHHcccEEHHHHEEHHHcccccEEEEEcc //