[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Escherichia coli str. K-12 substr. MG1655 (ecol0)
Gene : rsxA
DDBJ      :rsxA         predicted inner membrane subunit
Swiss-Prot:RNFA_SHIDS   RecName: Full=Electron transport complex protein rnfA;

Homologs  Archaea  2/68 : Bacteria  288/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:193 amino acids
:PSIPRED
:RPS:PFM   3->191 PF02508 * Rnf-Nqr 1e-38 56.5 %
:HMM:PFM   1->191 PF02508 * Rnf-Nqr 2.8e-74 54.5 189/190  
:BLT:SWISS 1->193 RNFA_SHIDS 6e-96 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD PEC GenoBase Abbreviations Back to title page
GT:ID AAC74699.1 GT:GENE rsxA GT:PRODUCT predicted inner membrane subunit GT:DATABASE GIB00009CH01 GT:ORG ecol0 GB:ACCESSION GIB00009CH01 GB:LOCATION 1703791..1704372 GB:FROM 1703791 GB:TO 1704372 GB:DIRECTION + GB:GENE rsxA GB:PRODUCT predicted inner membrane subunit GB:NOTE GO_component: GO:0009274 - peptidoglycan-based cell wall GB:PROTEIN_ID AAC74699.1 GB:DB_XREF GI:1787914 ASAP:ABE-0005450 UniProtKB/Swiss-Prot:P0A766 EcoGene:EG13933 GB:GENE:GENE rsxA LENGTH 193 SQ:AASEQ MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL GT:EXON 1|1-193:0| SW:ID RNFA_SHIDS SW:DE RecName: Full=Electron transport complex protein rnfA; SW:GN Name=rnfA; OrderedLocusNames=SDY_1850; SW:KW Cell inner membrane; Cell membrane; Complete proteome;Electron transport; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->193|RNFA_SHIDS|6e-96|100.0|193/193| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 6 TM:REGION 6->28| TM:REGION 38->60| TM:REGION 67->89| TM:REGION 100->122| TM:REGION 134->155| TM:REGION 166->188| SEG 12->25|vlvnnfvlvkflgl| RP:PFM:NREP 1 RP:PFM:REP 3->191|PF02508|1e-38|56.5|184/187|Rnf-Nqr| HM:PFM:NREP 1 HM:PFM:REP 1->191|PF02508|2.8e-74|54.5|189/190|Rnf-Nqr| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02508|IPR003667| OP:NHOMO 576 OP:NHOMOORG 291 OP:PATTERN -------------------------------------------------21----------------- --------------------------------------------------------------------------------2-------3333-333----1--11-----111111111111111---2-322-23----------------------------------------------------22--------------------------------------------------------------------------------------------------------------------------------------31-22222222-2--111222-12223121--------24--11---2---1------------------------------------------------------------------2222-11-------------2------------------------------------2---------------------------------------------------41-1--311111111--343-24422222-522---------1-------11---------------------------444332332333433333333343333433--3115121-11111121111111111111-1111111111111111111222112221111111111111111211111111-233333233333---3---------53313222233233332333-------111533223-11-2----5------------133323333333333--------------2212--------------2-2-------------------------2223223222--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccHHHHHHHHHHHHHHcccccccc //