[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Escherichia coli str. K-12 substr. MG1655 (ecol0)
Gene : hisQ
DDBJ      :hisQ         histidine/lysine/arginine/ornithine transporter subunit
Swiss-Prot:HISQ_ECOLI   RecName: Full=Histidine transport system permease protein hisQ;

Homologs  Archaea  30/68 : Bacteria  679/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   55->156 3dhwA PDBj 6e-05 29.9 %
:RPS:PDB   117->154 3dhwA PDBj 3e-11 44.1 %
:RPS:SCOP  48->222 2r6gG1  f.58.1.1 * 1e-19 15.5 %
:RPS:PFM   57->154 PF00528 * BPD_transp_1 2e-05 36.7 %
:HMM:PFM   28->219 PF00528 * BPD_transp_1 4.7e-26 21.3 178/185  
:BLT:SWISS 1->228 HISQ_ECOLI e-113 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD PEC GenoBase Abbreviations Back to title page
GT:ID AAC75368.1 GT:GENE hisQ GT:PRODUCT histidine/lysine/arginine/ornithine transporter subunit GT:DATABASE GIB00009CH01 GT:ORG ecol0 GB:ACCESSION GIB00009CH01 GB:LOCATION complement(2423252..2423938) GB:FROM 2423252 GB:TO 2423938 GB:DIRECTION - GB:GENE hisQ GB:PRODUCT histidine/lysine/arginine/ornithine transporter subunit GB:FUNCTION transport; Transport of small molecules: Amino acids, amines GB:NOTE histidine transport system permease protein; membrane component of ABC superfamily; GO_component: GO:0009274 - peptidoglycan-based cell wall; GO_component: GO:0019866 - organelle inner membrane; GO_process: GO:0009089 - lysine biosynthetic process via diaminopimelate; GO_process: GO:0006526 - arginine biosynthetic process GB:PROTEIN_ID AAC75368.1 GB:DB_XREF GI:1788646 ASAP:ABE-0007615 UniProtKB/Swiss-Prot:P52094 EcoGene:EG12125 GB:GENE:GENE hisQ LENGTH 228 SQ:AASEQ MLYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVPDLVLMLLIFYGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAATAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKATQLAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVKRADL GT:EXON 1|1-228:0| SW:ID HISQ_ECOLI SW:DE RecName: Full=Histidine transport system permease protein hisQ; SW:GN Name=hisQ; OrderedLocusNames=b2308, JW2305; SW:KW Amino-acid transport; Cell inner membrane; Cell membrane;Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->228|HISQ_ECOLI|e-113|100.0|228/228| GO:SWS:NREP 6 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 4 TM:REGION 10->32| TM:REGION 54->76| TM:REGION 89->111| TM:REGION 192->214| SEG 19->40|laissvvlaviigligaggkls| BL:PDB:NREP 1 BL:PDB:REP 55->156|3dhwA|6e-05|29.9|87/203| RP:PDB:NREP 1 RP:PDB:REP 117->154|3dhwA|3e-11|44.1|34/203| RP:PFM:NREP 1 RP:PFM:REP 57->154|PF00528|2e-05|36.7|90/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 28->219|PF00528|4.7e-26|21.3|178/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 48->222|2r6gG1|1e-19|15.5|168/284|f.58.1.1| OP:NHOMO 3857 OP:NHOMOORG 713 OP:PATTERN 11--12----------1-1111114--11-2211----1122--2212--1-1----2------2--- ----41111112112------3---A------42221387-3114143211-536115----214667272533343321221---------------------------11111111111111-----1--4------441111-1212--13322----1--1--2221--111---111-1341111--263444447644554456233874452136543455543852222222222222222222365448A554465555A83646C43338888555499899877878876666566666666757988777813556564545523224442333112214233188-4132-1111111161--11112222221F57122211112375347567P-22E22A16AG13cOOMPSSRQdIMH6---25I45553591111111133411-35----------111111111111111--1-4--11-3B85DLKKLMIB9BBCDDIRDCDD9CFFV6762-15584464376CDHP242----934422222---24--1D-777A45888742-23-3-------1--5-3321444443312222222-13----88B-3-----A-1111--11111111-11-2---1--------9AIH6AB9999998998-89B999999989989988AGLEHG4449897999899999989D99899993-A9A999999999--3-222221111--69B45442533223333144444-44554-DDDCHNIPAFHCE5JHJ----------5558777778887711---------------2----------------31------------------------122-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------1-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 38.6 SQ:SECSTR ######################################################HHHHccHHHHHHHHHHHHHHTTcc###cccH#HHHHHHHHHHH#######HHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHH###HHHHHHHH######################################################################## DISOP:02AL 228-229| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //