[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ecol0:carA"

carA        "carbamoyl phosphate synthetase small subunit, glutamine amidotransferase"
CARA_ECOLI  "RecName: Full=Carbamoyl-phosphate synthase small chain;         EC=6.3.5.5;AltName: Full=Carbamoyl-phosphate synthetase glutamine chain;"

OrgPattern 11-1-12222222222-222222121111122231223222222222212232212--1--111--22 2212311111122222223-21112122222222221111222211121222222112111211111232122223332-1222212211112111-1111111111121--------------122222222122222221112222222221222222222221122222222222222223121122122333333333233333333223333332234423333333212222222222222221111131411433223333111222212222221222222111111111111111111111111211221111135-23---111-1-1334422222-3-12222233322111322222-31122211211111221111111111122222222222-22222222223122222222222222222222222222222222222222122221111111111---------------1111211111222222222223222222222222222222222222222222222221222221112222222222222221231311111111112222222221111312122221111111111111111222221111211221222111111111111111111111-222111111122222111111111111-11111111111111111112122222211211111111111112111111121111111111111122222122111122111---1-11----1--122222221122111111223221222222111111111211121111122212112222211111111121332222--------------------------------------2--21222221 11--113-311-1121223222222222222223222322232222232222222222222222222212222321312222222223-22222232223221343-22143322322121222432216H2-3221122212211221222122222226-13211211611412221I1212242542232243232 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHI:Sequence : ccEEEEEETTccEEEEEEccccEEEEEEEEEEcccccHHHHHTcGGGcTEEEEEccccc:Sec Str : ===========================================================:RP:SCP|2->152|1a9xB1|6e-77|100.0|151/151|c.8.3.1 :============================================================:BL:SWS|1->382|CARA_ECOLI|0.0|100.0|382/382 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->133|PF00988|5e-42|61.2|129/131|CPSase_sm_chain 61: . . . * . .: 120 :GNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTR:Sequence :cTTcccGGGcccccccccEEEccccccccccTTccccHHHHHHHTTcEEEEcccHHHHHH:Sec Str :============================================================:RP:SCP|2->152|1a9xB1|6e-77|100.0|151/151|c.8.3.1 :============================================================:BL:SWS|1->382|CARA_ECOLI|0.0|100.0|382/382 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->133|PF00988|5e-42|61.2|129/131|CPSase_sm_chain 121: . . + . . .: 180 :LLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGG:Sequence :HHHHHccEEEEEEEcccccHHHHHHHHHHccccTTcccHHHHcccccEEEccccccTTTc:Sec Str :================================ :RP:SCP|2->152|1a9xB1|6e-77|100.0|151/151|c.8.3.1 : ============================:RP:SCP|153->380|1a9xB2|e-104|98.7|228/228|c.23.16.1 :============================================================:BL:SWS|1->382|CARA_ECOLI|0.0|100.0|382/382 :$$$$$$$$$$$$$ :RP:PFM|5->133|PF00988|5e-42|61.2|129/131|CPSase_sm_chain 181: . * . . . .: 240 :LPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSN:Sequence :ccccccGGGccEEEEEEEccccHHHHHHHHHTTEEEEEEETTccHHHHHTTcccEEEEcc:Sec Str :============================================================:RP:SCP|153->380|1a9xB2|e-104|98.7|228/228|c.23.16.1 :============================================================:BL:SWS|1->382|CARA_ECOLI|0.0|100.0|382/382 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|196->370|PF00117|4e-28|39.7|174/185|GATase 241: + . . . . *: 300 :GPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDV:Sequence :cccccTTcHHHHHHHHHHHTTccccEEEEHHHHHHHHHTTccEEEEEEEEEEEEEEEEET:Sec Str :============================================================:RP:SCP|153->380|1a9xB2|e-104|98.7|228/228|c.23.16.1 :============================================================:BL:SWS|1->382|CARA_ECOLI|0.0|100.0|382/382 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|196->370|PF00117|4e-28|39.7|174/185|GATase 301: . . . . + .: 360 :EKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGP:Sequence :TTTEEEEEEEEEEEEEccTTccTTEEEEEEETTTccEEEEEEccccEEEEcccTTccccc:Sec Str :============================================================:RP:SCP|153->380|1a9xB2|e-104|98.7|228/228|c.23.16.1 :============================================================:BL:SWS|1->382|CARA_ECOLI|0.0|100.0|382/382 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|196->370|PF00117|4e-28|39.7|174/185|GATase 361: . . . * . .: 420 :HDAAPLFDHFIELIEQYRKTAK :Sequence :cTTTHHHHHHHHHHHHHHHcEE :Sec Str :==================== :RP:SCP|153->380|1a9xB2|e-104|98.7|228/228|c.23.16.1 :====================== :BL:SWS|1->382|CARA_ECOLI|0.0|100.0|382/382 :$$$$$$$$$$ :RP:PFM|196->370|PF00117|4e-28|39.7|174/185|GATase