[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ecol0:dgkA"

dgkA        "diacylglycerol kinase"
KDGL_SHIFL  "RecName: Full=Diacylglycerol kinase;         Short=DAGK;         EC=2.7.1.107;AltName: Full=Diglyceride kinase;         Short=DGK;"

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------1--111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------1-11------1111--------1111---1111111---1111-111111111311-111111111111111111---212--1-1---1--11------------------------------1111-111111---111112-112-211111-22111111111211------1------11111111231111111-211111111121111111111111111111111111111111111111111--111111111111---1---------1-11311111111111111111111111111111111111121112111---------111111111122122221111111111111-1-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLI:Sequence : ccccccHHHHHHHHHTHHHHHHHHTTTTTHHHHHHHHHHHHHHHHHHccccccHHHHHH:Sec Str :============================================================:BL:SWS|1->122|KDGL_SHIFL|8e-59|100.0|122/122 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->99|PF01219|2e-16|51.2|84/104|DAGK_prokar 61: . . . * . .: 120 :SSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVITWCILLWSH:Sequence :HHHHHHHHHHTHHHHHHHHHTTccccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHTT:Sec Str : XXXXXXXXXXXX :SEG|100->111|aavliaiivavi : ############ :PROS|70->81|PS01069|DAGK_PROKAR|PDOC00820| :============================================================:BL:SWS|1->122|KDGL_SHIFL|8e-59|100.0|122/122 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|16->99|PF01219|2e-16|51.2|84/104|DAGK_prokar 121: . . + . . .: 180 :FG :Sequence :cc :Sec Str :== :BL:SWS|1->122|KDGL_SHIFL|8e-59|100.0|122/122