[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAC77012.1 ecol0 dgkA "diacylglycerol kinase"
MANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIACWLDVDAITRVLLI
SSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLIAIIVAVITWCILLWSH
FG
//