[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ecol0:hisQ"

hisQ        "histidine/lysine/arginine/ornithine transporter subunit"
HISQ_ECOLI  "RecName: Full=Histidine transport system permease protein hisQ;"

OrgPattern 11--12----------1-1111114--11-2211----1122--2212--1-1----2------2--- ----41111112112------3---A------42221387-3114143211-536115----214667272533343321221---------------------------11111111111111-----1--4------441111-1212--13322----1--1--2221--111---111-1341111--263444447644554456233874452136543455543852222222222222222222365448A554465555A83646C43338888555499899877878876666566666666757988777813556564545523224442333112214233188-4132-1111111161--11112222221F57122211112375347567P-22E22A16AG13cOOMPSSRQdIMH6---25I45553591111111133411-35----------111111111111111--1-4--11-3B85DLKKLMIB9BBCDDIRDCDD9CFFV6762-15584464376CDHP242----934422222---24--1D-777A45888742-23-3-------1--5-3321444443312222222-13----88B-3-----A-1111--11111111-11-2---1--------9AIH6AB9999998998-89B999999989989988AGLEHG4449897999899999989D99899993-A9A999999999--3-222221111--69B45442533223333144444-44554-DDDCHNIPAFHCE5JHJ----------5558777778887711---------------2----------------31------------------------122-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------1-----------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVP:Sequence : HHHHcc:Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|19->40|laissvvlaviigligaggkls : =============:RP:SCP|48->222|2r6gG1|1e-19|15.5|168/284|f.58.1.1 :============================================================:BL:SWS|1->228|HISQ_ECOLI|e-113|100.0|228/228 : $$$$:RP:PFM|57->154|PF00528|2e-05|36.7|90/195|BPD_transp_1 61: . . . * . .: 120 :DLVLMLLIFYGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP:Sequence :HHHHHHHHHHHHHHTTcc cccH HHHHHHHHHHH HHHHHHHHHHHHHHcc:Sec Str :============================================================:RP:SCP|48->222|2r6gG1|1e-19|15.5|168/284|f.58.1.1 :============================================================:BL:SWS|1->228|HISQ_ECOLI|e-113|100.0|228/228 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|57->154|PF00528|2e-05|36.7|90/195|BPD_transp_1 121: . . + . . .: 180 :KGHIEAATAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKAT:Sequence :TTTTTHHHHHTccTHHHHHHTTHHH HHHHHHHH :Sec Str :============================================================:RP:SCP|48->222|2r6gG1|1e-19|15.5|168/284|f.58.1.1 :============================================================:BL:SWS|1->228|HISQ_ECOLI|e-113|100.0|228/228 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|57->154|PF00528|2e-05|36.7|90/195|BPD_transp_1 181: . * . . . .: 240 :QLAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVKRADL :Sequence : :Sec Str :========================================== :RP:SCP|48->222|2r6gG1|1e-19|15.5|168/284|f.58.1.1 :================================================ :BL:SWS|1->228|HISQ_ECOLI|e-113|100.0|228/228