[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ecol0:malG"

malG        "maltose transporter subunit"
MALG_SHIFL  "RecName: Full=Maltose transport system permease protein malG;"

OrgPattern 221-32-1111111116-2121--71141-1-----------------------2352111332---- --11a213334-1123344-413348444443155514565425HzS29GH4NKM129--667BB3DLUG47666DC91---4------------------------11---------------------------8AA77---76221311-11222222222221333--1-----1----EE244BC-953111111221121112MD884711253828346676669*111111111111111-----4311121-12122--11---1-41442324233411666776766664333344443333444---344384-18111113141491--1444P-24242C--341--1J--1766B2-1-------1111131HDB31-446645576567566B---8--5-18L--WVVJXVRpjcWS32---9H97758D85--------3112--12---------------------------------2-1333358877553444448D5554447553333--2228-23332867C----1--3--------11----1-1--111--1111-1--------222234----------1------------------125-1---1-4----------------------1---------26661412222222222-22222223222212222215656511123222222222222226---2221--599999989999---------11111-75E111111-----1--1------1---1-11111233432343656----------2333333333165511212122221111-------------------17----------1-----1---1----6MDB98Q8CA-3- -------------2------------------------------------------------------------------------------------------------------------------------------------------------2-----------1-----------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWK:Sequence : ccccTTHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHcccccccccccccccccHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|11->32|arlfithlllllfiaaimfpll : ==================:RP:SCP|43->296|2r6gG1|2e-35|97.6|248/284|f.58.1.1 :============================================================:BL:SWS|1->296|MALG_SHIFL|e-154|100.0|296/296 61: . . . * . .: 120 :LALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKAT:Sequence :HHccccc ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcHH:Sec Str :============================================================:RP:SCP|43->296|2r6gG1|2e-35|97.6|248/284|f.58.1.1 :============================================================:BL:SWS|1->296|MALG_SHIFL|e-154|100.0|296/296 121: . . + . . .: 180 :LLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGY:Sequence :HHHHHHHTTccccccHHHHHHHHHHHHHHHcTTccTTcHHHHHHHHTTTTHHHHHHHHHH:Sec Str :============================================================:RP:SCP|43->296|2r6gG1|2e-35|97.6|248/284|f.58.1.1 :============================================================:BL:SWS|1->296|MALG_SHIFL|e-154|100.0|296/296 181: . * . . . .: 240 :FETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDV:Sequence :HTTccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHcccG:Sec Str :============================================================:RP:SCP|43->296|2r6gG1|2e-35|97.6|248/284|f.58.1.1 :============================================================:BL:SWS|1->296|MALG_SHIFL|e-154|100.0|296/296 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|182->236|PF00528|3e-06|47.3|55/195|BPD_transp_1 241: + . . . . *: 300 :NSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG :Sequence :GGccHHHHGGGGcccccccHHHHHHHHHHTHHHHHHHHHHHTTTccccccTTTccc :Sec Str :======================================================== :RP:SCP|43->296|2r6gG1|2e-35|97.6|248/284|f.58.1.1 :======================================================== :BL:SWS|1->296|MALG_SHIFL|e-154|100.0|296/296