[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ecol0:rsxA"

rsxA        "predicted inner membrane subunit"
RNFA_SHIDS  "RecName: Full=Electron transport complex protein rnfA;"

OrgPattern -------------------------------------------------21----------------- --------------------------------------------------------------------------------2-------3333-333----1--11-----111111111111111---2-322-23----------------------------------------------------22--------------------------------------------------------------------------------------------------------------------------------------31-22222222-2--111222-12223121--------24--11---2---1------------------------------------------------------------------2222-11-------------2------------------------------------2---------------------------------------------------41-1--311111111--343-24422222-522---------1-------11---------------------------444332332333433333333343333433--3115121-11111121111111111111-1111111111111111111222112221111111111111111211111111-233333233333---3---------53313222233233332333-------111533223-11-2----5------------133323333333333--------------2212--------------2-2-------------------------2223223222--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID:Sequence : XXXXXXXXXXXXXX :SEG|12->25|vlvnnfvlvkflgl :============================================================:BL:SWS|1->193|RNFA_SHIDS|6e-96|100.0|193/193 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->191|PF02508|1e-38|56.5|184/187|Rnf-Nqr 61: . . . * . .: 120 :TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA:Sequence :============================================================:BL:SWS|1->193|RNFA_SHIDS|6e-96|100.0|193/193 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->191|PF02508|1e-38|56.5|184/187|Rnf-Nqr 121: . . + . . .: 180 :LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM:Sequence :============================================================:BL:SWS|1->193|RNFA_SHIDS|6e-96|100.0|193/193 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->191|PF02508|1e-38|56.5|184/187|Rnf-Nqr 181: . * . . . .: 240 :SLAFMGFSGLVKL :Sequence :============= :BL:SWS|1->193|RNFA_SHIDS|6e-96|100.0|193/193 :$$$$$$$$$$$ :RP:PFM|3->191|PF02508|1e-38|56.5|184/187|Rnf-Nqr