[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAC74699.1 ecol0 rsxA "predicted inner membrane subunit"
MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID
TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA
LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM
SLAFMGFSGLVKL
//