[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ecol0:thiQ"

thiQ        "thiamin transporter subunit"
THIQ_ECOLI  "RecName: Full=Thiamine import ATP-binding protein thiQ;         EC=3.6.3.-;"

OrgPattern TTNCTNJIWVVSWQaPkITSPSQYyOSkoYhXJCDEGCHGGFEXaSXlMR**i9PaRVWLTJLHZ18A YatR*limuuxVgVcYbSR-RnBBb*SSSSSQ*uvw****W*c****h*piS***RZnFF***o*w****jfcbb*ebhU*lqBBDACVUUP5OGKM--EGTLLKkQaRS899999ADDCBBBBHUROUcROXXcVr****LKM*cyor*mlqjnYbUNSMTKfkep***eMWJONNNUJNHLoejXSuiBei*************************hq***nr***wwz**cmopnpljmmnnmmlahdcc*nfh**iSkfr**SS**gXTfmljjmtuyxvrz*yxv*wwury*twxcbbabcdfgedbb*vrkjjwtwmq***********k*nw***ammi*tmx**mrVN**ypceipUelcmnTZciOgYZZPNNMLOjd***gZz****************-***zt*z***XC**************MLP**********aZaaaaaa*ilPWqg*886878887768ABEF9CCCBAAABA8C8MFFKGJ************************w********BR****y*tz******guvRbMYrfKMKKMKKVURivoe**Ula*tcxzhftKffcZYboWdfhegw*a*KMNRHNNNOKGCCEFFEEEEHVFHLVU*x*T*XiLVO*VZdeaTajZXYaabffche6-GMcUQ321333****g************-*************z***z******rsjwyuwtxyxxxvwxwwv*yrxzzy*Y5************55JJEGDEFPQSQRP*r*fecbdZMSUQNVRVgQSTSSHTJTYwi********z****n***GGGEFHGFGKmts*uvvvv*****USWOSPPQRTFEEE85PVUTMNOOAA8A88A9*CeEDCCH-GBEFLJDRQPCHOEHJBBCWqxXYo*qqnFjQ 2366aUK-gK8DPaRICLFHJMJSHSFGFBD9DQMNBJFGGHGDDBHGJRQKcRHHOAEDDEAA979728A67BA9A27A87799958-PRACGFHCDBBD8FMIF9S*lydicvhpPJJEJaLzvE*E**o4oUxLOLAeDLkZDPLGCfIB*HcWTzMq*PzVdG*ko*fefTIMNI*JHGPP*mx*G**GL*lvxX ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGSLTIDG:Sequence :============================================================:RP:SCP|1->197|1sgwA|5e-39|22.5|191/200|c.37.1.12 :============================================================:BL:SWS|1->232|THIQ_ECOLI|e-121|100.0|232/232 : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|39->158|PF00005|2e-23|46.6|118/123|ABC_tran 61: . . . * . .: 120 :VDHTTMPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQGKMHAIARQMGID:Sequence :============================================================:RP:SCP|1->197|1sgwA|5e-39|22.5|191/200|c.37.1.12 :============================================================:BL:SWS|1->232|THIQ_ECOLI|e-121|100.0|232/232 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|39->158|PF00005|2e-23|46.6|118/123|ABC_tran 121: . . + . . .: 180 :NLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQK:Sequence : ############### :PROS|130->144|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|1->197|1sgwA|5e-39|22.5|191/200|c.37.1.12 :============================================================:BL:SWS|1->232|THIQ_ECOLI|e-121|100.0|232/232 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|39->158|PF00005|2e-23|46.6|118/123|ABC_tran 181: . * . . . .: 240 :MTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKASASALLGITG :Sequence : XXXXXXXXXXXXX :SEG|217->229|llsgkasasallg :================= :RP:SCP|1->197|1sgwA|5e-39|22.5|191/200|c.37.1.12 :==================================================== :BL:SWS|1->232|THIQ_ECOLI|e-121|100.0|232/232