[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAC73177.1 ecol0 thiQ "thiamin transporter subunit"
MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGSLTIDG
VDHTTMPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQGKMHAIARQMGID
NLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQQK
MTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKASASALLGITG
//